KEGG   Bos taurus (cow): 781146Help
Entry
781146            CDS       T01008                                 

Definition
lysozyme (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
bta  Bos taurus (cow)
Brite
Enzymes [BR:bta01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     781146
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
5
AA seq 147 aa AA seqDB search
MKALLILGLLLLSVAVQGKTFKRCELAKTLKNLGLAGYKGVSLANWMCLAKGESNYNTQA
KNYNPGSKSTDYGIFQINSKWWCNDGKTPKAVNGCGVSCSALLKDDITQAVACAKKIVSQ
QGITAWVAWKNKCRNRDLTSYVKGCGV
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctctccttattctggggcttctgctcctttctgttgctgtccagggcaagaca
tttaagaggtgtgagcttgccaaaactctgaagaatcttggattggctggctacaaggga
gtcagcctggcaaactggatgtgtttggccaaaggagaaagcaattataacacacaagct
aaaaactataatcctggaagcaaaagcactgattatgggatatttcagatcaacagcaaa
tggtggtgtaatgatggcaaaaccccaaaagcagttaacggctgtggtgtatcctgcagt
gctttgctgaaagatgacatcactcaagctgtagcatgtgcaaagaagattgtcagtcag
caaggcattacagcatgggtggcatggaaaaacaagtgtcgaaaccgagatctcacaagt
tatgttaagggttgcggagtgtaa

DBGET integrated database retrieval system