KEGG   Bos taurus (cow): 781334Help
Entry
781334            CDS       T01008                                 

Gene name
TMSB4, TMSB4X
Definition
(RefSeq) thymosin beta 4, X-linked
  KO
K05764  thymosin, beta 4
Organism
bta  Bos taurus (cow)
Pathway
bta04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:bta00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    781334 (TMSB4)
Cytoskeleton proteins [BR:bta04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Thymosin
     781334 (TMSB4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thymosin WH2 DUF4522
Motif
Other DBs
NCBI-GeneID: 781334
NCBI-ProteinID: NP_001106702
Ensembl: ENSBTAG00000005414
UniProt: P62326 C1K3N7
Position
1
AA seq 44 aa AA seqDB search
MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
NT seq 135 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacaaacccgatatggctgagattgagaagttcgataagtcgaaattgaagaaa
acggaaacgcaagagaaaaatccactgccttcgaaagaaacgattgaacaggagaagcaa
gcaggcgagtcgtaa

DBGET integrated database retrieval system