KEGG   Bos taurus (cow): 781334Help
Entry
781334            CDS       T01008                                 

Gene name
TMSB4, TMSB4X
Definition
thymosin beta 4, X-linked
Orthology
K05764  
thymosin, beta 4
Organism
bta  Bos taurus (cow)
Pathway
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:bta00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    781334 (TMSB4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 44 aa AA seqDB search
MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
NT seq 135 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacaaacccgatatggctgagattgagaagttcgataagtcgaaattgaagaaa
acggaaacgcaagagaaaaatccactgccttcgaaagaaacgattgaacaggagaagcaa
gcaggcgagtcgtaa

DBGET integrated database retrieval system