KEGG   Bos taurus (cow): 781478Help
Entry
781478            CDS       T01008                                 

Definition
UDP-glucuronosyltransferase 2B18-like
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
bta  Bos taurus (cow)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis
Module
Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    781478
   00053 Ascorbate and aldarate metabolism
    781478
   00500 Starch and sucrose metabolism
    781478
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    781478
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    781478
   00860 Porphyrin and chlorophyll metabolism
    781478
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    781478
   00982 Drug metabolism - cytochrome P450
    781478
   00983 Drug metabolism - other enzymes
    781478
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    781478
Enzymes [BR:bta01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     781478
Glycosyltransferases [BR:bta01003]
 Others
  Hydrophobic molecule
   781478
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
6
AA seq 539 aa AA seqDB search
MSKRWAFLLVLSFYFSCDFCEKVLVCPMEXNHXINFKTVLDELAQRDHEVTVLASSASIL
VDPSKPSTLKFEAYPISFTKNEPDLHFMKXIKIWAYELPKSTLWAYDSKMQKTYHKYSDT
VQKLYADAVLNKKLMKKLRESRCDVVLRDAISPCVELLVKLLTLPLVYSLKFTTGNTYGK
LCGGLIXPPSYIPIIIFELSDKMIFMERVTNMVYDLYFDFXHETFNKKWDKFYSEVLGRP
TTICELMXKTDFWLIKSSWDFEFPQPFLPNFDFVGGLHXKPAKPLHKEIEEFVQSSGEDG
FVILILGSVVENLPEERSNMIVSTLAQIPITFVVWXFSGKKPDMLGNNTHLFKWIQQNDL
VGQPKTKAFITHGGGNGIPEAIYHMIPMMGLPMFVNQPNNTAHMEAKGIAXLDLNTMSSA
DLLSALKTVIYDPLXKGNAMKLSRIHHDQPVRPLDXAVYWTEFAICYKGAKHVWPATHNL
TWXXYHSLDVIGFLLACVATVVFVITICYLFWFWKFAKTGKKEKREYLYLRTGASLLHR
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgtctaagagatgggcttttcttcttgtgctttctttttatttcagctgtgacttctgt
gaaaaggtgctggtgtgtccaatggaatagaatcactagatcaatttcaagacagttttg
gatgaacttgctcagagggatcatgaagtgactgtgctagcatcttcagcttccatcctg
gtggatcccagtaaaccatctacccttaaatttgaggcttatcctatatccttcactaag
aatgagcctgatttgcattttatgaaatagatcaagatatgggcatatgaattaccaaag
agtacattatgggcatatgattcaaagatgcaaaaaacatatcacaaatattctgatact
gttcaaaagctctatgcggatgcagttttaaacaaaaaacttatgaaaaaactgagagag
tccagatgtgatgttgttcttagagatgcaatttctccttgtgttgagctgctggttaaa
ctgcttaccctacctttggtctacagtcttaaatttaccacaggcaatacatatggaaaa
ctctgtggagggcttatatgacctccttcctacatacctattataatatttgaactaagt
gacaaaatgatatttatggagagagtgacaaatatggtgtatgacctatattttgacttt
nngcatgagacttttaacaagaagtgggataaattttacagtgaagtattaggaagaccc
actacaatctgtgaattaatgnagaaaactgatttttggttgataaaaagctcttgggat
tttgaatttccccaaccattcttaccaaattttgattttgttggaggacttcactgaaaa
cctgccaaacccctgcacaaggaaattgaagagtttgtccaaagctctggagaagatggc
tttgtaatactgattttggggtcagtggttgaaaaccttccagaagaaaggtctaatatg
attgtatcaacccttgcccagattccaattacctttgttgtgtggtgattcagtgggaag
aaaccagatatgttgggaaataacactcatctttttaagtggatccaacagaatgatctt
gttggtcaaccgaaaaccaaagcttttatcactcatggtggtggcaatggcattcctgaa
gccatttaccatatgattcccatgatgggactccctatgtttgttaaccaacccaataat
acagctcacatggaggccaagggaatagctnnactagacttgaacacaatgtcaagtgca
gacttgctcagtgcactgaagactgtcatttatgaccctttatagaaaggaaatgctatg
aagctatcaagaattcaccatgatcaacctgtaagacccctggactgagcagtctactgg
actgagtttgccatatgctacaaaggagccaagcacgtgtggccagccacccacaacctc
acctggtagtagtaccactcactggacgtgattgggttcctattggcttgtgtggcaact
gttgtatttgtcatcacaatatgctatctgttttggttctggaagtttgctaaaacagga
aagaaggagaaaagggaatatctgtatctgagaactggagcaagtttactccatagatga

DBGET integrated database retrieval system