KEGG   Bos taurus (cow): 781718Help
Entry
781718            CDS       T01008                                 

Gene name
USP27X
Definition
ubiquitin specific peptidase 27, X-linked (EC:3.1.2.15)
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.4.19.12]
Organism
bta  Bos taurus (cow)
Brite
Enzymes [BR:bta01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     781718 (USP27X)
Peptidases [BR:bta01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   781718 (USP27X)
Transcription machinery [BR:bta03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     781718 (USP27X)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
X
AA seq 438 aa AA seqDB search
MCKDYVYDRDIEQIAKEEQGEALKLQASTSTEVSHQQYSVPGLGEKYPTWETTKPELELL
GHNPRRRRIASSFTIGLRGLINLGNTCFMNCIVQALTHTPILRDFFLSDRHRCEMPSPEL
CLVCEMSSLFRELYSGNPSPHVPYKLLHLVWIHARHLAGYRQQDAHEFLIAALDVLHRHC
KGDDAGKAASNPNHCNCIIDQIFTGGLQSDVTCQACHGVSTTIDPCWDISLDLPGSCTSF
WPMSPGRESSVNGESHIPGITTLTDCLRRFTRPEHLGSSAKIKCGSCQSYQESTKQLTMN
KLPVVACFHFKRFEHSAKQRRKITTYISFPLELDMTPFMASSKESRMNGQLQLPTNSGND
ENKYSLFAVVNHQGTLESGHYTSFIRHHKDQWFKCDDAVITKASIKDVLDSEGYLLFYHK
QVLEHESEKVKEVNTQAY
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgtgtaaggactatgtatatgacagagacattgagcaaattgccaaagaagagcaaggg
gaagctttgaaattacaagcctccacctcgaccgaggtttctcaccagcagtattcagtg
ccaggcctcggtgagaagtatccaacctgggagacaaccaaacctgagttagaactgctg
ggccataacccaaggagaagaagaatcgcctccagctttaccatcggtttaagaggactg
atcaatcttggcaacacgtgctttatgaactgcatcgtccaggcccttacccacactccg
atcctgagagatttcttcctctctgacaggcacagatgtgaaatgccgagtccggagttg
tgtctggtctgtgagatgtcttcgctttttcgagagttgtattctggaaacccatctcct
catgttccctataagttactgcacctggtatggatacacgcacggcatttagcagggtac
aggcaacaggatgcacatgagtttctcattgcagcgttagatgtcctgcacaggcactgc
aaaggtgatgatgctgggaaggcggccagcaatcccaaccactgtaactgcatcattgac
caaattttcacaggtggcctgcaatctgatgtcacctgtcaagcctgtcatggtgtctcc
accacaatagacccatgctgggacatcagtttggacttgcctggctcttgtacctccttc
tggccgatgagcccagggagggagagcagtgttaacggggaaagccacataccaggaatc
actaccctcacggactgtctgcgaaggtttacgaggccagagcacttaggaagcagtgcc
aaaatcaagtgtggtagttgccaaagctaccaggaatctaccaaacagctcacaatgaat
aaattacctgtcgttgcctgttttcatttcaaacggtttgaacactcagccaaacagagg
cgcaagatcactacatacatatcctttcctctggagctggatatgacacctttcatggcc
tcgagtaaagagagcaggatgaatggacagttgcagctgccaaccaatagtggaaacgat
gagaataagtattccttgtttgctgtggttaatcaccaaggaaccttggagagtggccac
tacaccagcttcatccggcaccacaaggaccagtggttcaagtgtgatgatgccgtcatc
accaaggccagtattaaggacgtgctggacagtgaagggtatttactgttctatcacaaa
caggtcctggaacacgaatcagaaaaagtgaaagaagtgaatacacaagcctactga

DBGET integrated database retrieval system