KEGG   Bos taurus (cow): 781908Help
Entry
781908            CDS       T01008                                 

Definition
ubiquitin carboxyl-terminal hydrolase 17-like protein 22-like
Orthology
K11845  
ubiquitin carboxyl-terminal hydrolase 17 [EC:3.1.2.15]
Organism
bta  Bos taurus (cow)
Brite
Enzymes [BR:bta01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     781908
Peptidases [BR:bta01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   781908
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 533 aa AA seqDB search
METLVGLVCRAPGAASEHGGGVCPSPFDVFPGGQGCGPSGAGADALWGPSVPEGPSPALG
RPQRGDLAPGSAGLTPGQKGALSWKGPWGVGAGLQNLGNTCYVNAALQCLSHTPPLASWM
VSQQHATLCPARSACTLCAMRAHVTRALLHAGEVIRPRKDLLAGFHRHQQEDAHEFLMFT
LNAMQQGCLSASQPSGHASEDTTVIRQIFGGTWRSQIQCLRCLGVSDTFDPYLDISLDIT
AAQSVEQALRELVKPEKLDADNAYDCGVCLRKVPATKRLTLHSTSQVLVLVLKRFTPVSG
AKRAQEVRYPQCLDLQPYTSERKAGPLGYVLYAVLVHSGWSCERGHYFYYVRAGNGQWYK
MDDAKVTACDETAALSQSAYVLFYAREGAWEGGAGGGAAAPVGADPTEPGQPAGDASGRV
PGSEESPGDTEVEGMSLEQWRRLQEHSRPKPALELRKVQSALPAGAVVIHQSKHGGGRNR
TPPQQEHERLDRPSTDTPPPGPKNVGNGPCAGGRARATKGKNKKPRPSLGLWR
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccctcgtgggccttgtgtgcagagccccgggggctgcttctgagcacggggga
ggtgtgtgtccgtctcccttcgacgtcttccccggagggcaaggttgtgggcccagcggc
gctggtgcggatgccctttggggaccctctgtccctgaggggccgtcgccggcgcttggg
cgtccccagcggggtgacttggctcctgggtcagcagggctgacgcctggccagaaaggc
gccctgagttggaaggggccgtggggggtgggggctgggcttcagaacctggggaacacc
tgctacgtgaatgcggcgctgcagtgtctgagccacacgccgcccctggccagctggatg
gtgtcccagcagcacgccaccctctgtccggcccgcagcgcctgcacgctctgtgccatg
cgagctcacgtgacccgagccctccttcacgcgggagaggtgatccggccccgcaaggac
ctgctggcgggcttccacagacaccagcaggaagatgcccacgagtttctgatgttcact
ctgaatgccatgcagcaagggtgcttgagtgcatcccagccgtcgggccatgcctccgag
gacaccaccgtcatccgtcagatcttcggcgggacctggaggtctcagatccagtgtctc
cgctgcctcggtgtctcggacacgttcgacccttatctggacatcagcctggatatcacg
gcggcccagagtgtggagcaagctctgagagagctggtgaagcccgagaagctggacgcg
gacaatgcctatgactgtggcgtctgtctccggaaggtgcctgccaccaagaggttgact
ttgcacagcacctcccaggtcctggtgctggtgctgaagcggttcacaccggtgagcggg
gccaaaagggctcaggaggtgcgctatccccagtgcttggacctgcagccctacacgtct
gagcggaaggcagggccactgggctacgtgctctatgccgtgctggtgcactccgggtgg
agctgtgagcgaggacactacttctattacgtccgagcgggcaacggccaatggtataag
atggacgatgccaaggtgaccgcctgtgacgagaccgctgccctgagccagagcgcctac
gtcctgttctacgcccgggagggtgcgtgggaagggggcgctgggggaggggcagcggcc
cccgtcggggctgaccccacagagcccgggcagcctgcaggagacgccagcggcagagtt
cctgggtcggaggagtccccgggggacacagaggtcgaagggatgagcttagagcagtgg
agacgcctgcaagaacacagccgaccgaagccggccttggagctgcggaaggtccagtct
gccctgcctgccggcgcagtcgtgattcaccagtccaaacacggaggagggagaaaccgc
acgccgccccaacaggagcacgagcggctcgaccgtcccagcacggacaccccgcctccg
gggccgaagaacgtcggcaacggcccttgtgccggcgggagggccagagccaccaagggg
aagaacaagaagccgcggccgtctctggggctgtggcggtag

DBGET integrated database retrieval system