KEGG   Bos taurus (cow): 781996Help
Entry
781996            CDS       T01008                                 

Gene name
CYCT
Definition
(RefSeq) cytochrome c, testis
  KO
K08738  cytochrome c
Organism
bta  Bos taurus (cow)
Pathway
bta01524  Platinum drug resistance
bta04115  p53 signaling pathway
bta04210  Apoptosis
bta04215  Apoptosis - multiple species
bta04932  Non-alcoholic fatty liver disease (NAFLD)
bta05010  Alzheimer's disease
bta05012  Parkinson's disease
bta05014  Amyotrophic lateral sclerosis (ALS)
bta05016  Huntington's disease
bta05134  Legionellosis
bta05145  Toxoplasmosis
bta05152  Tuberculosis
bta05161  Hepatitis B
bta05164  Influenza A
bta05167  Kaposi's sarcoma-associated herpesvirus infection
bta05168  Herpes simplex infection
bta05200  Pathways in cancer
bta05210  Colorectal cancer
bta05222  Small cell lung cancer
bta05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:bta00001]
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    781996 (CYCT)
   04215 Apoptosis - multiple species
    781996 (CYCT)
   04115 p53 signaling pathway
    781996 (CYCT)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    781996 (CYCT)
   05210 Colorectal cancer
    781996 (CYCT)
   05222 Small cell lung cancer
    781996 (CYCT)
  Neurodegenerative diseases
   05010 Alzheimer's disease
    781996 (CYCT)
   05012 Parkinson's disease
    781996 (CYCT)
   05014 Amyotrophic lateral sclerosis (ALS)
    781996 (CYCT)
   05016 Huntington's disease
    781996 (CYCT)
  Cardiovascular diseases
   05416 Viral myocarditis
    781996 (CYCT)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    781996 (CYCT)
  Infectious diseases
   05134 Legionellosis
    781996 (CYCT)
   05152 Tuberculosis
    781996 (CYCT)
   05164 Influenza A
    781996 (CYCT)
   05161 Hepatitis B
    781996 (CYCT)
   05168 Herpes simplex infection
    781996 (CYCT)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    781996 (CYCT)
   05145 Toxoplasmosis
    781996 (CYCT)
  Drug resistance
   01524 Platinum drug resistance
    781996 (CYCT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Motif
Other DBs
NCBI-GeneID: 781996
NCBI-ProteinID: NP_001071431
BGD-bta: BT28967
Ensembl: ENSBTAG00000039522
UniProt: Q3SZT9
Position
2
AA seq 105 aa AA seqDB search
MADAEAGKKIFIQKCAQCHTVEKGGKHKTGPNLWGLFGRKTGQAPGFSYTEANKNKGIIW
GEQTLMEYLENPKKYIPGTKMIFAGLKKKSEREDLIEYLKQATSS
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atggcagatgctgaggcaggcaagaagatctttattcaaaaatgtgctcagtgccacaca
gtggagaaaggcggaaaacacaagactggtccaaatctctggggcctttttggcagaaaa
acaggacaagcgccaggattttcttataccgaggcaaacaaaaacaaaggcattatctgg
ggagagcagactctgatggaatatttggagaacccaaagaaatatatccctggaacgaaa
atgatctttgctggtcttaaaaagaagagtgagagagaagatcttattgagtatttgaaa
caggcaacatcttcatga

DBGET integrated database retrieval system