KEGG   Bos taurus (cow): 782350Help
Entry
782350            CDS       T01008                                 

Definition
histone cluster 2, H2be-like
Orthology
K11252  
histone H2B
Organism
bta  Bos taurus (cow)
Pathway
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus
Class
Human Diseases; Cancers; Viral carcinogenesis [PATH:bta05203]
Human Diseases; Immune diseases; Systemic lupus erythematosus [PATH:bta05322]
Human Diseases; Substance dependence; Alcoholism [PATH:bta05034]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
Position
6
AA seq 128 aa AA seqDB search
MPEPAKSAPNATPKKGSKKAVTKAQKKDCKKCKCSCKESYSVYVYKVLRQVHPDTGIWSK
AMGIMNSFVNDIFEHIAGKASHLAHYNKRSTITSREIQTTVSLLLPGELAKLAMSEGTKA
VTKYTSSK
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaaccagctaagtctgctcctaatgcaacccctaaaaagggctctaaaaaagct
gtgaccaaggcccagaagaaggactgcaagaagtgcaagtgcagctgcaaggagagctac
tccgtatacgtgtacaaggtgctgaggcaagtccatccggacactggcatctggtccaag
gccatgggaatcatgaactccttcgtcaacgacatttttgagcacatcgctggcaaggca
tcacacctggcgcattacaacaagcgctcgactatcacatccagggagatccagaccacc
gtaagcttgctgctacctggggagctagccaagcttgccatgtccgagggcactaaggct
gtcaccaagtataccagctccaagtaa

DBGET integrated database retrieval system