KEGG   Bos taurus (cow): 782652Help
Entry
782652            CDS       T01008                                 

Gene name
FCGR2C
Definition
Fc fragment of IgG, low affinity IIc, receptor for (CD32)
Orthology
K16824  
low affinity immunoglobulin gamma Fc region receptor II-c
Organism
bta  Bos taurus (cow)
Pathway
Phagosome
Osteoclast differentiation
Leishmaniasis
Staphylococcus aureus infection
Tuberculosis
Brite
KEGG Orthology (KO) [BR:bta00001]
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    782652 (FCGR2C)
 Organismal Systems
  Development
   04380 Osteoclast differentiation
    782652 (FCGR2C)
 Human Diseases
  Infectious diseases
   05150 Staphylococcus aureus infection
    782652 (FCGR2C)
   05152 Tuberculosis
    782652 (FCGR2C)
   05140 Leishmaniasis
    782652 (FCGR2C)
Cellular antigens [BR:bta04090]
 Proteins
  782652 (FCGR2C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
3
AA seq 278 aa AA seqDB search
MGIPSFLAFPAARRNRAHCTPWHPWGHMLLWTALPFLAPVPGKCADLPKAVVSIQPAWIN
VLREDHVTLMCQGTSFSAGNLTTWFHNGSSIHTQKQPSYSFRAGSNDGGSYRCQREQTSL
SDPVHLDVISDWLLLQTPSLVFQEGEPIMLRCHSWRNQPLNKITFYQDGKSKTFSYQRTN
FSIPRANLSHRGQYHCTAFIGKMLHSSQPVNITVQDGNEGPAVPLIFSPWYQITFCLVMG
LLLAVDTGLYFSVQRDLQSSMGDGKNNKVRWSQDPQDK
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atggggatcccctcattcctagccttccctgctgccaggaggaaccgagctcactgcacg
ccctggcatccttggggccacatgctcctgtggacagctctgcctttcctggctcctgtt
cctgggaaatgtgcagatctcccaaaagctgtggtgagcatccagcctgcgtggatcaat
gtgctcagggaggatcacgtgacgctgatgtgccaggggaccagcttctctgcaggcaac
ctcaccacatggttccataacgggagctccatccacacccagaagcagcccagctacagc
tttagggccggcagcaatgacggtgggtcctacaggtgccagagggagcagaccagcctc
agcgaccctgtgcatctggatgtgatttccgactggctgctgctccagacccccagcctc
gtgttccaggaaggggagcccatcatgctgaggtgccacagctggagaaaccaacctctg
aataagatcacgttctaccaggatgggaaatccaagacattttcctatcagcgcaccaac
ttctctatcccacgcgccaacctcagtcacagaggccagtaccactgcacagcgtttatc
gggaagatgctacactcatcacagccagtgaacatcactgtccaagatgggaatgaaggt
ccagcagttccactcatcttttcaccttggtatcaaatcactttctgcctggtgatggga
ctccttttggcagtggatacaggcctgtatttttcagtgcagagagaccttcaaagctcc
atgggagacgggaagaataacaaagtcagatggagccaagaccctcaggacaaatga

DBGET integrated database retrieval system