KEGG   Bos taurus (cow): 782652Help
Entry
782652            CDS       T01008                                 

Gene name
FCGR2C
Definition
Fc fragment of IgG, low affinity IIc, receptor for (CD32)
Orthology
K16824  
low affinity immunoglobulin gamma Fc region receptor II-c
Organism
bta  Bos taurus (cow)
Pathway
Phagosome
Osteoclast differentiation
Leishmaniasis
Staphylococcus aureus infection
Tuberculosis
Class
Cellular Processes; Transport and catabolism; Phagosome [PATH:bta04145]
Organismal Systems; Development; Osteoclast differentiation [PATH:bta04380]
Human Diseases; Infectious diseases; Staphylococcus aureus infection [PATH:bta05150]
Human Diseases; Infectious diseases; Tuberculosis [PATH:bta05152]
Human Diseases; Infectious diseases; Leishmaniasis [PATH:bta05140]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
3
AA seq 278 aa AA seqDB search
MGIPSFLAFPAARRNRAHCTPWHPWGHMLLWTALPFLAPVPGKCADLPKAVVSIQPAWIN
VLREDHVTLMCQGTSFSAGNLTTWFHNGSSIHTQKQPSYSFRAGSNDGGSYRCQREQTSL
SDPVHLDVISDWLLLQTPSLVFQEGEPIMLRCHSWRNQPLNKITFYQDGKSKTFSYQRTN
FSIPRANLSHRGQYHCTAFIGKMLHSSQPVNITVQDGNEGPAVPLIFSPWYQITFCLVMG
LLLAVDTGLYFSVQRDLQSSMGDGKNNKVRWSQDPQDK
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atggggatcccctcattcctagccttccctgctgccaggaggaaccgagctcactgcacg
ccctggcatccttggggccacatgctcctgtggacagctctgcctttcctggctcctgtt
cctgggaaatgtgcagatctcccaaaagctgtggtgagcatccagcctgcgtggatcaat
gtgctcagggaggatcacgtgacgctgatgtgccaggggaccagcttctctgcaggcaac
ctcaccacatggttccataacgggagctccatccacacccagaagcagcccagctacagc
tttagggccggcagcaatgacggtgggtcctacaggtgccagagggagcagaccagcctc
agcgaccctgtgcatctggatgtgatttccgactggctgctgctccagacccccagcctc
gtgttccaggaaggggagcccatcatgctgaggtgccacagctggagaaaccaacctctg
aataagatcacgttctaccaggatgggaaatccaagacattttcctatcagcgcaccaac
ttctctatcccacgcgccaacctcagtcacagaggccagtaccactgcacagcgtttatc
gggaagatgctacactcatcacagccagtgaacatcactgtccaagatgggaatgaaggt
ccagcagttccactcatcttttcaccttggtatcaaatcactttctgcctggtgatggga
ctccttttggcagtggatacaggcctgtatttttcagtgcagagagaccttcaaagctcc
atgggagacgggaagaataacaaagtcagatggagccaagaccctcaggacaaatga

DBGET integrated database retrieval system