KEGG   Bos taurus (cow): 782887Help
Entry
782887            CDS       T01008                                 

Gene name
SETD1A
Definition
SET domain containing 1A (EC:2.1.1.43)
Orthology
K11422  
histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
bta  Bos taurus (cow)
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:bta00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
Position
25
AA seq 1708 aa AA seqDB search
MDQEGGGDGQKAPSFQWRNYKLIVDPALDPALRRPSQKVYRYDGIHFSVNDSKYIPVEDL
QDPRCHVRSKNRDFSLPVPKFKLDEFYIGQIPLKEVTFARLNDNVRETFLKDMCRKYGEV
EEVEILLHPRTRKHLGLARVLFTSTRGAKETVKNLHLTSVMGNIIHAQLDIKGQQRMKYY
ELIVNGSYTPQTVPTGGKALSEKFQGSGAATETTDSRRRSSSDTAAFPAGSAVVGTPGNG
TPCSQDTSFSSSRQDTPSSFGQFTPQSSQGTPYTSRGSTPYSQDSAYSSSTTSTSFKPRR
SENSYQDSFSRRHFSASSAPTTTSAAICATTAATASASSSSSLSSSSSSSSSSSSSHFRG
SDSNYPAYYESWNRYQRHASYPPRRATRDEPPGASFAENTAERFTPSYTSYLPPEPNRPA
DQDYRPPASEAPPPEPPEPGGGGGGGGPSPEREEARTSPRPASPARSGSPAPETTNESVP
FAQHSSLDSRIEMLLKEQRSKFSFLASDTEEEEENSSTGPGARDTGSEAPSGSGHGPCTP
PPAPASFEDVAPTGSGEPGATRESPKANGQNQASPCSSGEDMEISDDDRGGSPPPAPTPP
QQPPPPPPPPPPPPPYLASLPLGYPPHQPAYLLPPRPDGPPPPEYPPPPPPPPHIYDFVN
SLELMDRLGAQWGGMPMSFQMQTQMLTRLHQLRQGKGLTAASAGPPGGAFGEAFLPFPPH
QEAAYGLPYALYAQGQEGRGAYSREAYHLPLPMAAEPLPSSVSGEEARLPPREEAELAEG
KALPSAGTVGRVLATLVQEMKSIMQRDLNRKMVENVAFGAFDQWWESKEEKAKPFQNAAK
QQAKEEDKEKTKLKEPGLLSLVDWAKSGGTTGIEAFAFGSGLRGALRLPSFKVKRKEPSE
ISEASEEKRPRPSTPAEEDEDDAEREKEVGEPGRPGTKPPKRDEERSKTQGKHRKSFALD
SEGEEASQESSSEKDEEDEEEDEEDEEREEAMDAAKKETEASDGEDGESDSSSKCSLYAD
SDGENDSTSDSESSGSSSSSSSSSSSSSSSSSSSSSESSSEEEEEEEQPAIILAALSPPR
DVPTPLSAPAEEPEPERVEDSPVTPLPEQEKSPVRPAGSTEEPPSSAPQPPPEPPAGPLA
PTPRPDDRPSSPIPLLPPPKKRRKTVSFSAVEEAPAPEPPPAALPQAKSSGPASRKAPRA
VERTIRNLPLDHASLVKSWPEEVSRGGRNRAGGRGRSAEEEEAEPATEVDLAVLADLALT
PARRGLPALPAADDSEAAETPDEAERPGPLLSHILLEHNYALAVRPPLPPPPPPSTPAPR
PLEPVPAPAALFSSPADEVLEAPEVVVAEVEEPKQPPQQQEDGEEEEEEEEESESSESSS
SSSSDGEGATRRRSLRSHTRRRRPPPPPPPPPPPTFDPRSEFEQMTILYDIWNSGLDLED
MSYLRLTYERLLQQTSGADWLNDTHWVQHTITNLSTPKRKRRPQDGPREHQTGSARSEGY
YPISKKEKDRYLDVCPVSARQLEGVDTQGTNRVLSERRSEQRRLLSAIGTSAIMDSDLLK
LNQLKFRKKKLRFGRSRIHEWGLFAMEPIAADEMVIEYVGQNIRQMVADMREKRYVQEGI
GSSYLFRVDHDTIIDATKCGNLARFINHCCTPNCYAKVITIESQKKIVIYSKQPIGVDEE
ITYDYKFPLEDNKIPCLCGTESCRGSLN
NT seq 5127 nt NT seq  +upstreamnt  +downstreamnt
atggatcaggaaggtgggggagatgggcagaaggccccgagcttccagtggcggaactac
aagctcatcgtggatcctgccttggaccctgccctacgcaggccttctcaaaaggtgtac
agatacgatggaatccactttagtgtcaacgactcaaagtatataccagtggaggacctc
caagacccccgttgccacgtcaggtccaaaaacagagacttttccctcccagtccctaag
tttaagctggatgagttctatattggacagatcccactgaaagaagtgacattcgcaagg
ctgaatgacaatgtgcgggagaccttcctgaaggatatgtgccgaaagtatggtgaggtg
gaagaggtagagatccttctccacccccgtactcgcaagcacctgggcctggcccgcgtg
ctcttcaccagcactcggggagccaaggaaacagtcaaaaacctccaccttacctccgtc
atgggcaacatcatccatgcccagctcgacatcaaaggtcaacaacgaatgaaatactat
gaactgatagtcaacggctcctacacccctcagacggtgcccactgggggcaaggccctg
agtgagaagttccaaggctctggtgcagccacggagacgaccgactcccgccgccgctcc
tcgtcagacacagctgccttcccggcaggctcggctgtggtgggcactcccggcaatggc
accccctgctcccaagacacaagcttctccagcagccgacaggacaccccgtcttccttt
ggccagttcacccctcagtcctcccaaggaaccccctacacgtctcggggcagcaccccc
tactctcaggactctgcctactccagcagcaccacttcaacctccttcaagccccggcgg
tcagagaacagctaccaagattccttctcccgccgccatttctccgcctcttcggccccc
acaaccacctctgccgccatctgcgccaccactgcagccaccgcctccgcctcctcgtcg
tcctcgttgtcttcgtcctcttcgtcgtcctcttcgtcctcctcctctcactttcgtggt
tccgactcaaactacccagcatattacgaaagctggaatcgctaccaacgccatgcttcc
tacccaccccgccgggcaactcgggacgagccccccggggcctcttttgccgaaaatacc
gctgagcgcttcacgccatcctacacctcctacttgccccccgagcccaaccggcctgct
gaccaggactaccggcctcctgcctccgaagctccacccccagagcctccagaacctggt
ggaggagggggcggcggggggcccagccccgagagagaagaagctcgaacctccccgcgc
ccagcctcaccggcccgttctggctccccagccccagagaccaccaacgagagcgtgccc
ttcgctcagcacagcagcctggattcccgcattgagatgttgttgaaggagcagcgttcc
aagttttccttcctggcctctgacaccgaggaagaggaagagaacagcagcacaggcccg
ggggctcgggacacaggaagcgaggccccttctgggtctggtcacgggccctgcacaccc
cctccagccccggcgagttttgaggatgtggcacctacagggagtggagaaccaggagct
acccgggagtcgcccaaggccaatggacagaaccaggcttctccatgctcttccggagag
gacatggaaatctccgacgacgacaggggcggctcaccccctccggccccgacacccccc
cagcaacctccaccccctccgccgccacctcccccaccccctccttacctggcttccctt
ccccttggttatcctccccaccagcctgcctacctcctccccccgcgacccgacgggccg
ccgcctcccgagtacccccctcctcctccgccacccccccacatctatgactttgtgaac
tccttagagctcatggatcgacttggggctcagtggggaggaatgcccatgtccttccag
atgcagacccagatgttaactcggctccaccagctgcggcagggcaaaggattgaccgcg
gcctcagcgggtccccccggtggggcctttggggaggccttcctcccattcccaccccac
caagaggcggcctacggcctaccatacgctctgtacgctcaagggcaagaaggccgaggg
gcatactcccgggaggcctaccacctgcctttgcccatggcagccgagcccctgccctcc
tcagtctcaggagaagaggcccggctgcccccccgggaggaagcagagctggccgagggc
aaggccctaccctcggcaggcaccgtgggccgtgtactggccaccctggtccaggagatg
aagagcatcatgcagcgagacctcaaccgcaagatggtggagaacgtggcctttggagcc
tttgaccagtggtgggagagcaaggaagagaaggccaagccattccagaatgcagctaaa
cagcaagccaaggaggaggataaagagaagacaaagctcaaagagccaggcctgctgtcc
ctcgtagactgggccaagagtggcggtaccaccggcatcgaagccttcgcctttggatca
ggactgcgaggggccctgcggctgccttctttcaaggtaaagcgaaaagagccttcggaa
atttcagaggccagtgaggaaaagaggccccggccttctactccagctgaggaagatgaa
gatgatgctgagcgagagaaggaggttggagagccaggccgtccggggaccaagcccccg
aaacgagatgaagagcgaagcaagacccagggcaagcaccgcaagtcttttgctctggac
agcgaaggggaggaagcatcccaggagtcctcctcagagaaggatgaggaggatgaagag
gaagatgaagaagatgaagagcgtgaggaagccatggatgctgcaaagaaggagacagaa
gcatcagacggcgaggacggggaaagcgattcgtcctccaaatgttctctgtatgctgac
tcagatggtgagaacgatagcacgtcggactctgagagcagcggttcctccagctcctcg
tcttcttcatcttcttcgtcttcatcctcgtcctcctcctcctcatctgagtcctcctcg
gaagaagaagaggaagaggagcaaccagcaatcatactcgcagcattgtcgccccctaga
gatgtccccacgcccctgtcagcacctgcagaggagcccgagccagaaagggttgaagac
tccccagtcacacctctccccgaacaggagaagtctcctgtgagacctgcaggttccact
gaggaaccgccttccagtgcaccccagcctcccccagagccaccagctggacccctggcc
cccaccccccgccccgacgatcgcccctcctctcccatccctctcctacccccacccaag
aaacgccggaaaaccgtctccttctctgcggtggaggaggcaccagccccagagcctccc
cccgccgccctgccacaggccaagtcctccggccctgcctctcgcaaagccccccgggct
gtggagcggaccattcgcaacctgcccctcgaccacgcctctctggtcaagagttggccc
gaggaggtgtcccgaggaggccggaaccgggccggaggccggggccgctccgccgaggaa
gaggaggctgaaccggccacagaagtggacctggccgtgctggctgacctggccctgacc
ccagcacggcgtggcctgcccgctctgcccgccgccgacgactcggaggccgcggagaca
ccggacgaggccgagcgcccgggtcccctgctcagccacatcctcctggagcacaactac
gccctggccgtcaggccgccgctgccgcccccgccgccaccctccacgcctgctcctcgt
cccttggaacccgttccggcccccgcggccctcttcagctccccggcagacgaggtcctt
gaggccccggaggtggttgtggccgaggtggaggagccaaagcagccaccacagcagcag
gaggacggagaggaggaggaggaagaggaagaggagtcggagtcatcggagagcagcagc
agcagcagcagcgacggcgagggcgccacccggcggcgcagcctccgttcgcacacgcgg
cgccggcggccgcccccacccccgcccccgccgccgccccccaccttcgatccccgcagc
gagtttgagcagatgaccatcctctatgacatttggaactcgggcctggacttggaggac
atgagctacctgcggctgacgtacgagcggcttctgcagcagactagtggggccgactgg
ctgaacgacacccactgggtccagcacaccatcaccaacctgagcactccgaaacgcaag
cggcggccccaagacgggccccgggagcaccagacaggctcagcccgcagtgaaggctac
taccccatcagcaagaaggagaaggaccggtacctggacgtgtgccctgtctcggcccgg
cagctggaaggagtggatactcaggggactaaccgcgtgctttcggagcgccggtcagag
cagcggcggctgctgagcgccattggcacctctgccatcatggacagcgatctgctgaag
ttaaaccagctcaagttccggaagaagaagctccgattcggccggagccggatccacgag
tggggactgtttgccatggaacccatcgccgctgacgagatggtcatcgaatacgtgggt
cagaacattcgccagatggtggccgacatgcgggagaaacgctacgtgcaggagggcatt
ggcagcagctacctgttccgggtagaccacgacaccatcatcgacgccaccaagtgcggc
aacctggcgaggttcatcaaccactgctgcacgcccaactgctatgccaaggtgatcacc
atcgagtcccagaagaagatcgtgatctactcgaagcagccgatcggcgtggatgaggag
atcacctacgactacaagttcccgctggaggacaacaagatcccgtgtctgtgcggcacg
gagagctgccgcggctccctcaactga

DBGET integrated database retrieval system