KEGG   Bos taurus (cow): 784720Help
Entry
784720            CDS       T01008                                 

Gene name
ELP3
Definition
elongation protein 3 homolog (S. cerevisiae) (EC:2.3.1.48)
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
bta  Bos taurus (cow)
Brite
Enzymes [BR:bta01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     784720 (ELP3)
Transfer RNA biogenesis [BR:bta03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    784720 (ELP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
8
AA seq 547 aa AA seqDB search
MRQKRKGDLSPAQLMMLTIGDVIKQLIEAHEQGKDIDLNKVKTRTAAKYGLSAQPRLVDI
IAAVPPQYRKVLVPKLKAKPIRTASGIAVVAVMCKPHRCPHISFTGNICVYCPGGPDSDF
EYSTQSYTGYEPTSMRAIRARYDPYLQTRHRIEQLKQLGHSVDKVEFIVMGGTFMALPEE
YRDYFIRNLHDALSGHTSNNIYEAVKYSERSLTKCIGITIETRPDYCMKRHLSDMLTYGC
TRLEIGVQSVYEDVARDTNRGHTVKAVCESFHLAKDSGFKVVAHMMPDLPNVGLERDIEQ
FTEFFENPAFRPDGLKLYPTLVIRGTGLYELWKSGRYKSYSPSDLIELVARILALVPPWT
RVYRVQRDIPMPLVSSGVEHGNLRELAFARMKDLGIQCRDVRTREVGIQEIHHKVRPYQV
ELVRRDYVANGGWETFLSYEDPDQDILIGLLRLRKCSEETFRFELVGGVSIVRELHVYGS
VVPVSSRDPTKFQHQGFGMLLMEEAERIAREEHGSGKIAVISGVGTRNYYRKIGYRLQGP
YMVKTLE
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgaggcagaagcgcaaaggcgacctcagccctgctcagctaatgatgctgaccatagga
gatgttattaaacaactaattgaagctcacgaacaggggaaagacatcgatctaaataag
gtgaagaccaggacagctgccaaatacgggctctcggcacagccccgcctggtggacatc
atcgccgcggtcccgcctcagtatcggaaggtcttggtccccaagctgaaggcgaaaccc
atcagaaccgccagtgggattgctgttgtggctgtcatgtgcaaaccccacagatgtcca
cacatcagttttacaggaaatatatgtgtgtactgccctggcggacctgattcagatttc
gaatattccacccagtcttacactggatatgagccaacctccatgcgagctatccgtgcc
aggtatgacccttacctgcagacaagacaccggatcgaacagttaaaacagcttggtcac
agtgtggataaagtggaatttatcgtgatgggtggaacatttatggcccttccagaagaa
tacagagattattttattcgaaatttacatgatgccttatcaggacatacctccaacaat
atttatgaggccgtcaagtattctgagagaagcctcacaaagtgcatcggaattactatt
gagaccagaccagattactgcatgaagcggcatctcagtgacatgttgacctatggctgc
acaaggctggagattggggtgcagagtgtctatgaggatgtggccagagataccaaccgg
ggccacactgtgaaggcagtgtgcgagtccttccacctggccaaagattctggcttcaaa
gtggtggctcacatgatgcctgatctgccgaacgtggggctggagagagacattgaacag
ttcacagagtttttcgagaacccagctttccgtcctgacggtttgaaactctaccctacc
ctggtgattcgtgggacagggctctatgagctgtggaagtcaggaagatacaagagttat
tcccccagcgacctgatcgagttggtggcccggatcctggccctcgtgcccccgtggact
cgagtgtaccgcgtgcagagagatattccaatgccgttagtcagctcaggagtggagcac
ggaaacttgagagagctggcatttgcaagaatgaaagaccttggaatacagtgtcgtgat
gtgagaaccagagaggtgggaatccaagaaattcatcacaaagtccggccataccaggtt
gaattggtgagaagagattatgttgcaaatggaggctgggaaaccttcttatcgtatgaa
gacccagatcaggacatcttgattggcctcctgagattacggaagtgttcagaggagaca
ttccgtttcgaattggttgggggtgtgtccatagtccgagagctgcacgtgtacggaagt
gtggttcccgtaagcagtcgggatcccactaaatttcagcatcagggctttggcatgctg
ctgatggaggaagcagaacgaatagccagagaagaacatggatctgggaaaatagctgtt
atatcaggggtcggcaccaggaattattacagaaagattggctacagattgcaaggtcca
tacatggtaaagacgctagaataa

DBGET integrated database retrieval system