KEGG   Bos taurus (cow): 785824Help
Entry
785824            CDS       T01008                                 

Gene name
MGC127055
Definition
uncharacterized LOC785824
Orthology
K07414  
cytochrome P450, family 2, subfamily D [EC:1.14.14.1]
Organism
bta  Bos taurus (cow)
Pathway
Steroid hormone biosynthesis
Serotonergic synapse
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    785824 (MGC127055)
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    785824 (MGC127055)
Enzymes [BR:bta01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     785824 (MGC127055)
Cytochrome P450 [BR:bta00199]
 Cytochrome P450, animal type
  CYP2 family
   785824 (MGC127055)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
5
AA seq 500 aa AA seqDB search
MGLLSGDTLGPLAVALLIFLLLLDLMHRRSRWAPRYPPGPMPLPVLGNLLQVDFEDPRPS
FNQLRRRFGNVFSLQQVWTPVVVLNGLAAVREALVYRSQDTADRPPQALYKHLGFGPRAE
GVILARYGNAWREQRRFSLSTLRNFGLGKKSLEQWVTEEASCLCAAFADQAGHPFSPMDL
LNKAVSNVIASLTFGCRFEYNDPRIVKLLDVMEDGLKEEMKIMRQVVEAVPVLLSIPGLA
AKVVPGQKAFMTLVDELIAEQKMTRDPTQPPRHLTDAFLDEVKEAKGNPESSFSDENLRL
VVADLFSAGMVTTSTTLAWALLLMILHPDVQRRVQQEIDEVIGQVRRPEMGDQALMPFTV
AVVHEVQRFADIVPLGLPHMTSRDIEVQGFHIPKGTTLITNLSSVLKDETVWEKPFRFHP
EHFLDAQGRFVKQEAFIPFSAGRRACLGEPLARMELFLFFTSLLQHFSFSVPAGQPRPSD
HGVFVALVTPAPYQLCAVPR
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggggctgctgtctggggacacgctggggcccctggccgtggccctgctcatcttcttg
ctcttgctggacctgatgcaccggcgctcacgttgggccccacgatacccaccaggcccc
atgccgctgccggtgctgggcaatctgctgcaggtggacttcgaggacccacgtcccagc
tttaaccagttgcggcgccgtttcgggaacgtgttcagcctgcagcaggtctggacaccg
gtagtcgtgctcaacgggctggcggctgtgcgcgaggcgctggtgtaccgcagtcaggac
actgccgaccgtccacctcaggcactctacaagcacttgggtttcgggccgcgcgccgaa
ggagtgatcctggcgcgttatggcaacgcctggcgtgagcagcggcgtttctccctatcc
accctgcgcaacttcggcctggggaagaagtcactggagcagtgggtgaccgaggaggcc
tcgtgcctctgtgccgccttcgccgaccaggccggacatccctttagccccatggacctc
ctgaataaagcagtgagcaacgtgatcgcctccctgaccttcgggtgccgcttcgagtac
aatgatcctcgcatcgtcaagctgttggacgtgatggaagatgggctgaaggaagagatg
aaaataatgcgccaggtggtggaagctgtgccagtgctcctgagcatcccagggctggcc
gccaaggtcgtcccgggacagaaggccttcatgaccctggttgatgagctgatcgctgag
cagaagatgacccgggacccgacccagccaccccgacacctgacggatgccttcctggat
gaggtgaaggaggccaaggggaaccccgagagcagcttcagtgatgagaacctgcgcctg
gtggtggccgacctgttctccgccgggatggtcaccacctcgaccacactggcctgggcc
ctcctcctcatgatcctgcaccctgacgtgcagcgacgggtccagcaggaaatcgatgag
gtgatagggcaggtgaggcgaccagagatgggggatcaggccctcatgcccttcaccgtg
gccgtggtccatgaggtgcaacgctttgcggacatcgtccccctgggattgccccacatg
acatcccgtgacatcgaggtgcagggcttccacatccccaaggggacgacactcatcacc
aacctgtcgtcagtgctgaaggacgagaccgtctgggagaagcccttccgcttccacccg
gagcacttcctggatgcccagggccgcttcgtcaagcaggaggccttcatacccttctct
gcaggccgccgcgcgtgcctcggggagcccctggcccgcatggagctcttcctcttcttc
accagcctcttgcagcatttcagcttctcggtgcctgccgggcagcctcgccccagcgac
cacggtgtctttgtggccctggtgaccccagccccctaccagctctgtgcggtgccccgc
tag

DBGET integrated database retrieval system