KEGG   Bos taurus (cow): 785909Help
Entry
785909            CDS       T01008                                 

Gene name
CACNA2D2
Definition
calcium channel, voltage-dependent, alpha 2/delta subunit 2
Orthology
K04859  
voltage-dependent calcium channel alpha-2/delta-2
Organism
bta  Bos taurus (cow)
Pathway
MAPK signaling pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
Oxytocin signaling pathway
Hypertrophic cardiomyopathy (HCM)
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:bta00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    785909 (CACNA2D2)
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    785909 (CACNA2D2)
  Circulatory system
   04260 Cardiac muscle contraction
    785909 (CACNA2D2)
   04261 Adrenergic signaling in cardiomyocytes
    785909 (CACNA2D2)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    785909 (CACNA2D2)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    785909 (CACNA2D2)
   05414 Dilated cardiomyopathy (DCM)
    785909 (CACNA2D2)
Ion channels [BR:bta04040]
 Voltage-gated cation channels
  Ca2+ channel, CACN alpha-2 delta
   785909 (CACNA2D2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
Position
22
AA seq 1076 aa AA seqDB search
MQHWARRLEQEIDGVMRIFGGVQQLREIYKDNRNLFEVQENEPQKLVEKVAGDIESLLDR
KVQALKRLADAAETFQKAHRWQDNIKEEDIVYYDAKADAELDDPESEDVERGSKASTLRL
DFVEDSNFKNKVNYSYTAVQIPTDIYKGSTVILNELNWTEALENVFMENRRQDPTLLWQV
FGSATGVTRYYPATPWRAPKKIDLYDVRRRPWYIQGASSPKDMVIIVDVSGSVSGLTLKL
MKTSVCEMLDTLSDDDYVNVASFNEKAQPVSCFTHLVQANVRNKKVFKEAVQGMVAKGTT
GYKAGFEYAFDQLQNPNITRANCNKMIMMFTDGGEDRVQDVFEKYNWPNRTVRVFTFSVG
QHNYDVTPLQWMACTNKGYYFEIPSIGAIRINTQEYLDVLGRPMVLAGKEAKQVQWTNVY
EDALGLGMVVTGTLPVFNLTQDGPGEKKNQLILGVMGIDVALNDIKRLTPNYTLGANGYV
FAIDLNGYVLLHPNLKPQTTNFREPVTLDFLDAELEDENKEEIRRSMIDGNKGHKQIRTL
VKSLDERYIDEVTRNYTWVPIRSTNYSLGLVLPPYSTFYLQANLSDQILQVKYFEFLLPS
SFESEGHVFIAPREYCKDLNASDNNTEFLKNFIELMEKVTPDSKQCNNFLLHNLILDTGI
TQQLVERVWRDQDLNTYSLLAVFATTDGGITRVFPNKAAEDWTENPEPFNASFYRRSLDN
HGYVFKPPQQDALLRPLELENDTVGILVSTAVELSLGGRTLRPAVVGVKLDLEAWAEKFK
VLASNRTHQDQPQKCGPNSHCEMDCEVNNEDLLCVLIDDGGFLVLSNQNHQWDQVGRFFS
EVDANLMLALYNNSFYTRKESYDYQAACAPLPPGSLGAAPRGIFVPTIADFLNLAWWTSA
AAWSLFQQLLYGLIYHSWFQADPAEAEGNPEVRESSCVMKQTQYYFGSVNASYNAIIDCG
NCSRLFHAQRLINTNLLFVVAEKPLCSQCEAGRLLQKETHCPADGPEQCELVQRPRYRRG
PHICFDYNATEDTSDCGRGASFPPSLGVLVSLQLLLLLGLPPRPQPQVHAHPSRRL
NT seq 3231 nt NT seq  +upstreamnt  +downstreamnt
atgcagcactgggcccggcgcctggagcaggagattgatggtgtgatgcgaatctttggg
ggcgttcagcagctccgtgagatctacaaggacaacaggaatctgtttgaggtgcaggag
aatgagcctcagaagctggtggagaaggtggcgggggacattgagagcctgctggacagg
aaggtgcaggccctgaagagattggctgatgctgcagagaccttccagaaagctcaccgc
tggcaggacaacatcaaggaggaagacattgtgtactatgacgccaaagctgatgctgag
ctggacgaccctgagagtgaggatgtggaaaggggatccaaggccagcaccctccggctg
gacttcgttgaggactcaaacttcaagaacaaggtcaactattcatacacagccgtgcag
atccccacggacatctacaaaggctccaccgtcatcctcaatgagctcaactggacagag
gccctggagaatgtgttcatggagaaccgcaggcaggaccccacgctcctgtggcaggtc
tttggcagcgccacgggagtcactcgctactatccagctacgccgtggcgagcccccaag
aaaatcgacctgtacgatgtccgaaggagaccctggtatatccagggggcctcatcgccc
aaggacatggtcatcatcgtggatgtgagtggcagtgtgagtggcttaaccctgaagctg
atgaagacgtcagtctgtgagatgctcgacacgctctccgacgacgactatgtcaacgtg
gcctcgttcaatgaaaaggcacagcctgtgtcatgcttcacacacctggtgcaggccaac
gtgcgtaacaagaaggtgttcaaggaagctgtgcagggcatggtggccaagggcaccacg
gggtacaaggccggctttgagtacgccttcgaccagctgcagaaccccaacatcactcgt
gccaactgcaacaagatgatcatgatgttcacggatggcggtgaggaccgcgtgcaggac
gtctttgagaagtacaactggcccaaccggacggtgcgcgtgttcactttctccgtgggg
cagcacaactacgacgtcacaccgctgcagtggatggcctgcaccaacaaaggttactat
tttgagatcccttccattggtgccatccgcatcaacacgcaggaatatcttgacgtattg
ggcaggcccatggtgctggcgggcaaggaggccaagcaggtgcaatggactaatgtgtac
gaggatgcactggggctggggatggtggtgacagggaccctccctgttttcaacctgaca
caagacggccctggggaaaagaagaaccagctgatcctgggcgtgatgggcatcgatgtg
gctctgaatgacatcaagaggctgactcccaactacacacttggagccaacggctacgta
tttgccattgacctgaatggctacgtattgcttcacccgaacctcaagccccagaccacc
aacttccgggagcctgtgaccctggacttcctggatgcagagctggaggatgagaacaag
gaggagatccgcaggagcatgatcgatggcaacaagggccacaaacagatcagaaccctg
gtcaagtccttggacgagaggtacatagacgaggtgacgcggaactacacctgggtgccc
ataaggagtaccaactacagcctcgggctcgtgcttccaccctacagcaccttctacctc
caagccaacctcagcgaccagatcctacaggtcaagtattttgagttcctgctccccagc
agctttgagtctgaaggacatgttttcattgctcccagagagtattgcaaggacctgaat
gcctcagacaacaacaccgagttcctgaaaaacttcattgagctcatggagaaagtgact
ccagactccaaacagtgcaacaacttcctcctgcacaacctgatcctggacacaggcatc
acacagcagctggtggagcgcgtgtggcgggaccaggatctcaacacgtacagccttctg
gccgtgtttgccaccaccgacggtggcatcactcgagtgttccccaacaaggcagctgaa
gactggacagagaaccccgagcccttcaacgccagcttctaccgccgcagcctggacaac
cacggctatgtcttcaagcccccccagcaggatgccctgttaaggcctctggagctggag
aatgacacggtgggcatccttgtcagcacagctgtggagctcagcctgggtggacgtacg
ctgaggccagcagtggtaggcgttaagctggacctagaggcctgggctgagaagttcaag
gtgctagccagcaaccgtacccaccaggaccagcctcagaagtgtggccccaacagccac
tgtgagatggactgcgaggttaacaatgaggacctgctctgtgtcctcattgatgatggg
ggattcctggtgctgtcaaaccagaaccatcagtgggaccaggtgggcaggtttttcagt
gaagtggatgccaacctgatgctggcactctacaataactccttctacacccgcaaggag
tcctacgactatcaggcggcctgtgcccccttacccccgggcagcctgggtgctgcaccc
cggggcatctttgtgcccaccattgcagatttccttaacctagcctggtggacgtctgct
gcagcctggtctttgttccagcaacttctctatggtctcatctaccacagctggttccag
gcagaccccgcggaggccgaggggaaccccgaggtgcgcgagagcagttgcgtcatgaaa
cagacccagtactacttcggctcggtgaacgcctcctacaacgccatcatcgactgcgga
aactgctccaggctcttccacgcgcagagactgatcaacaccaaccttctcttcgtggtg
gccgagaagccgctgtgcagccagtgtgaagccggccggctactgcagaaagagacacac
tgcccagcggacggcccggagcagtgtgaactggtgcagagaccgcgataccggagaggc
ccacacatctgtttcgactacaacgccacggaagatacctcagactgtggccgcggagcc
tccttccccccgtcgttgggcgtcctggtgtccctccagctgctgctcctcctgggcctg
cctccccggccacagcctcaagtccatgcccacccctctcgccgactctga

DBGET integrated database retrieval system