KEGG   Bos taurus (cow): 786335Help
Entry
786335            CDS       T01008                                 

Gene name
GYS1
Definition
glycogen synthase 1 (muscle) (EC:2.4.1.11)
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
bta  Bos taurus (cow)
Pathway
Starch and sucrose metabolism
PI3K-Akt signaling pathway
AMPK signaling pathway
Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    786335 (GYS1)
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    786335 (GYS1)
   04152 AMPK signaling pathway
    786335 (GYS1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    786335 (GYS1)
Enzymes [BR:bta01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     786335 (GYS1)
Glycosyltransferases [BR:bta01003]
 Polysaccharide
  Storage polysaccharide
   786335 (GYS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
18
AA seq 736 aa AA seqDB search
MPLNRTLSMSSLPGLEDWEDEFDLENTVLFEVAWEVANKVGGIYTVLQTKAKVTGDEWGD
NYYLVGPYTEQGVRTQVELLEPPTPALKRTLDSMNSKGCKVYFGRWLIEGGPLVVLLDVG
ASAWALERWKGELWDTCNIGVPWYDREANDAVLFGFLTTWFLGEFLAQSEEKPHVVAHFH
EWLAGVGLCLCRARRLPVATIFTTHATLLGRYLCAGAVDFYNNLENFNVDKEAGERQIYH
RYCMERAAAHCAHVFTTVSQITAIEAQHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQS
KARIQEFVRGHFYGHLDFNLDKTLYFFIAGRYEFSNKGADVFLEALARLNYLLRVNGSEQ
TVVAFFIMPARTNNFNVETLKGQAVRKQLWDTANTVKEKFGRKLYESLLVGSLPDMNKML
DKEDFTMMKRAIFATQRQSFPPVCTHNMLDDSSDPILTTIRRIGLFNSSADRVKVIFHPE
FLSSTSPLLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVSTNLSGFGCFMEE
HIADPSAYGIYILDRRFRSLDDSCSQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKY
LGRYYMSARHMALAKAFPEYFTYEPHEADATQGYRYPRPASVPPSPSLSRHSSPHQSEDE
EEPRDLPPDEDDERYDEDEEAAKDRRNIRAPEWPRRASCTSSTGSKRGSVDTAPSSSVST
PSEPLSPASSLGEERN
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atgcctctaaaccgcactttgtccatgtcctccctgccaggactggaggactgggaggat
gaattcgacctggagaacacagtgctcttcgaggtggcctgggaggtggccaacaaggtg
ggcgggatctacacagtgctgcagacgaaggcaaaggtgacgggggacgagtggggtgac
aactactacctggtgggaccgtacacggagcagggcgtgaggacccaggtggagctgctg
gaacccccgaccccggccctgaagaggacgctggactccatgaacagcaagggctgcaag
gtgtacttcgggcgctggctgattgaggggggccccctggtggtgctcctcgatgtgggg
gcctcagcctgggccctggagcgctggaagggggagctatgggacacatgcaacatcggg
gtgccctggtacgaccgggaggccaacgacgccgtcctttttggcttcctcaccacctgg
ttcctgggtgagttcctggcccagagcgaggagaaaccacacgtggtcgcacacttccac
gagtggttggcaggtgtcgggctctgcctgtgccgcgcccggcggctgcccgtggctacc
atcttcaccacccacgccacgctgctggggcgatacctgtgtgctggggctgtggacttc
tacaacaacctggagaatttcaacgtggacaaagaagcaggtgagaggcaaatctatcac
cgctactgcatggagcgggccgcagcccactgcgctcatgtcttcactactgtgtcccag
attaccgccattgaggctcagcacctactcaaaaggaaaccagatatcgtgacccccaat
ggactgaatgtgaagaaattctctgccatgcatgagttccagaacctccatgctcagagc
aaggctcgaatccaggagtttgtgcggggccatttttatgggcacctagacttcaacttg
gacaagaccttgtacttctttatcgccggccgctatgagttctccaacaagggggctgac
gtcttcctggaggccttggcccggctcaactatctgctcagagtgaatggcagtgagcag
acggtggtcgccttcttcatcatgccggctcggaccaacaatttcaacgtggaaaccctt
aagggccaggccgtgcgcaagcagctttgggatacggccaacacagtgaaggaaaagttt
gggaggaagctttacgaatccttgctggtggggagcctcccagacatgaacaagatgctg
gacaaggaggacttcactatgatgaagagagctatctttgccacacagcggcaatctttc
cctcctgtgtgcacccacaatatgctggatgactcctcagaccccatcttgacaaccatc
cgccgaatcggcctctttaatagtagtgctgacagagtcaaggtgatttttcacccggag
ttcctgtcttctacgagccctctgctccctgtggactatgaggaatttgtccgtggctgc
caccttggggtcttcccctcctactatgagccttggggctacacaccagctgaatgcacg
gtaatgggtatccccagtgtctccaccaacctctccggattcggctgcttcatggaggaa
cacatcgcagacccctcagcttacggtatctacattctggaccggcgattccgcagtctg
gatgattcctgctcgcagctcacctccttcctctacagtttctgccagcagagccgaagg
cagcgcattatccagcggaaccgaacggagcgcctctctgaccttctggactggaaatac
ctaggccggtactacatgtcagcgcgccacatggcgctggccaaggcctttccagaatac
ttcacctacgagcctcacgaggctgacgcgacccagggctaccgctacccacggccagcc
tcagtgccaccatcaccctcgctgtcgcgacactccagcccgcaccagagcgaggatgag
gaggaaccccgggacttaccacctgatgaagatgacgagcgctacgacgaggacgaggag
gccgccaaggaccggcgcaacatccgcgcccccgagtggccacgccgcgcctcctgcacc
tcttccaccgggagcaagcgtgggtctgtggacacagcgccctccagctcagtcagcacc
cccagcgaaccccttagccccgccagctccctgggcgaggaacgcaactaa

DBGET integrated database retrieval system