KEGG   Bos taurus (cow): 786875Help
Entry
786875            CDS       T01008                                 

Gene name
USP31, USP48
Definition
ubiquitin specific peptidase 48
Orthology
K11852  
ubiquitin carboxyl-terminal hydrolase 31 [EC:3.4.19.12]
Organism
bta  Bos taurus (cow)
Brite
Enzymes [BR:bta01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     786875 (USP31)
Peptidases [BR:bta01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   786875 (USP31)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
25
AA seq 1266 aa AA seqDB search
DRGGLRSCFPPGPAAAPTPPPSCPPPPASPAPPACAAEPVPGVAGLRNHGNTCFMNATLQ
CLSNTELFAEYLALGQYRAGRPEPSPDPEQPAGRGEQGQGEVTEQLAHLVRALWTLEYTP
QHSRDFKSIVSKNALQYRGNSQHDAQEFLLWLLDRVHEDLNHAVKQSGQPPLKPPSETDM
MPEGPSFPVCSTFVQELFQAQYRSSLTCPHCQKQSNTFDPFLCISLPIPLPHTRPLYVTV
VYQGKCSHCMRVGVAVPLSGTVARLREAVSVETKIPTDQIVLTEMYYDGFHRSFCDTDDL
ETVHESDCIFAFETPEIFRPEGILSQRGIHLNNNLNHLKFGLDHCRLSSTQAAAKQGKAD
LPPSRAGSDKIVLLVCNRACTGQQGKRFGLPFVLHLEKTIAWDLLQKEILEKMKYFLRPT
VCIQVCPFSLRVVSVVGITYLLPQEEQPLCHPTVERALKSCGPGGTAHVKLVVEWDKETK
DFLFVNTEDEYIPDAESVRLQKERHHQPQTCTLSQCFQLYTKEERLAPDDAWRCPHCKQL
QQGSITLSLWTLPDVLIIHLKRFRQEGDKRMKLQNMVKFPLTGLDMTPHVVKRSQSSWSL
PSHWSPWRRPYGLGRDPEDYIYDLYAVCNHHGTMQGGHYTAFCKNSVDGLWYCFDDSDVQ
QLSEDEVCTQTAYILFYQRRTAIPSWSANSSVAGSTSSSLCEHWVSRLPGSKQASVTSAA
SSRRTSLASLSESVEMTGERSEDDGGFSTRPFVRSVQRQSLSSRPSVTSPLAVNENCMRP
SWSLSAKLQMRSSSPSRYSGDSPIHTSASTLEKIGEAMDDKVSISCFGSLRNLSSSHQDS
SDSHSRREHKAVGRAPLAVMEGVFRDESDTRKLNSSVADTQSRSSAHGDHLPPVSDPFDN
NNQIAYVDQSDSVDSSPVKEVKSPSHPGSLAKKPESTTKRSPSAKGASEPERSLRKGRPA
LASQESSLSSTSPSSPVPVKVSVKPSRSRSKADSSSRASGQHSSPAPAPKKESSPKSHES
VSSPSLQKQKSASSLAYTASSTSAKKASGPTPRGPFPPGKSRTSDRSLSREGSRHSLVSD
RASVTSSSKPNSPRVSQARAGDGRADSRHVRSSSMASLRSPSTSVRAGLKRDSKSEDKGL
SFFKSALRQKETRRSTDLGKTSLLSKKAGGGSVKSVCKSAVDDKAEKGSQAPGSQQPNAI
AVGKEPLASKDPSSGKHSLLSTRKSKTSQLDSAAPSSPGCRQSAEKSSKKLPSSMQTSAR
PSQKPQ
NT seq 3801 nt NT seq  +upstreamnt  +downstreamnt
gaccgcggtggcctccgcagctgcttcccgcccgggccggccgccgcgcccacgccgccg
ccgtcgtgcccgccgcctcccgcctcgcccgctccgcccgcctgcgccgcggagccggtg
cccggggtggcggggctccggaaccacggcaacacgtgcttcatgaacgccacgctgcag
tgtctcagcaacacggagctcttcgccgagtacctggcgctcggccagtaccgggcgggg
cggcccgagccctcgcctgaccccgagcagcccgcgggccgcggcgagcagggccagggc
gaggtcaccgagcagctggcgcacctggtgcgggccctctggaccttggagtacaccccg
cagcacagccgcgacttcaagagtattgtgtcaaagaatgcactgcagtatcggggaaat
tcccagcacgatgcccaggagtttctcctgtggcttttggaccgagttcacgaagacctc
aatcacgctgtgaagcagagtggccagcctcctctgaagccaccatcagagactgatatg
atgcctgagggaccatcttttcctgtctgtagcacttttgtacaagaactttttcaagcc
caatacagatcttctttgacgtgtcctcattgtcagaagcagagcaacacttttgatcct
ttcctctgcatttctttgccaattcctctaccccacacaaggcctctctatgtcaccgta
gtgtatcaggggaaatgctctcactgcatgcgggttggcgtggccgtgcctctgtctggg
actgtcgccagacttcgggaagcagtgtccgtggaaacaaagatccccactgatcagatt
gtgttaacagaaatgtactatgatgggttccatcgttccttttgtgacacagacgacctg
gaaacagtccatgaaagtgactgcatttttgcctttgagactccagaaatatttaggcct
gaaggaattctcagtcaaagaggaattcacttaaacaacaacctaaaccacttgaagttt
ggcttggatcactgtagactgtcttctacacaagccgcagcaaagcaggggaaagcggac
ttgcccccctcaagagcaggaagcgacaagatcgttctgttagtctgtaaccgagcctgc
acggggcagcaagggaaaagatttggacttccttttgtgctgcacttagagaagacaata
gcatgggaccttctgcagaaggaaatcttggagaagatgaagtacttcctgaggcccaca
gtttgcattcaggtgtgtccgttcagtttgcgtgtggtcagtgttgtgggaataacgtac
ttgctgccccaggaggagcaacctctgtgccacccgacagtagaaagggcactaaaatct
tgtggaccaggcggtactgctcacgtgaaattagtagtagaatgggacaaggagacaaaa
gattttttgtttgtaaatactgaggatgagtatatccctgatgcagagagcgtccggctg
cagaaggagcgtcaccaccagcctcagacctgcactttatcccagtgtttccaactctac
accaaagaggagcggctcgcccctgacgacgcctggcggtgcccgcactgtaagcagctg
caacaaggcagcattacattgagcctctggactctgcccgacgtgctgattatccatctg
aagagatttcgacaggaaggagacaagcgtatgaaacttcagaacatggtcaagttccct
ttgaccggcctggacatgacacctcacgtggttaagcgaagccagagcagctggagtctg
ccatcccactggtctccatggagacggccctacggactcgggagggaccctgaggactac
atctatgacctgtatgccgtgtgcaatcatcatggcaccatgcaaggggggcactacaca
gcgttctgcaagaactccgtggacggtctctggtactgcttcgacgacagtgacgtgcag
cagctgtcggaagatgaggtctgcacgcagacggcgtacatcctcttctaccagaggcgg
acggctataccgtcgtggtcggccaacagctcggtggcgggctccacgagttcctccttg
tgcgaacactgggtgagccgactcccggggagcaagcaagccagcgtgacctctgcggct
tcctccagacgcacctccctggcctcgctgtcagagtctgtggagatgaccggggagagg
agtgaagacgacggaggcttctcaactcgtccgttcgtgagaagtgtccagcgccagagc
ttgtcatccagaccgtctgtcaccagccccttggccgtcaatgaaaactgcatgcggcct
tcctggtccctgtctgccaagctgcagatgcgctccagttccccttcccgctactcaggg
gactctccaattcacacctctgcatccaccctggagaagatcggggaggccatggatgac
aaggtctccatctcctgcttcggtagcttgaggaacctgtccagcagccaccaggactcg
agcgacagtcacagtcggcgggagcacaaggctgtgggtcgggcccctctggccgtcatg
gaaggtgtgttcagagacgagtcggacacccgcaagttgaactccagcgtggcggacaca
cagagcagaagctcagcacatggggatcacttgccccccgtctctgatccatttgataac
aataaccagattgcttatgtggatcagagcgattctgtagacagctctcccgtcaaagag
gtgaaatccccaagccacccaggctccctcgcaaagaaaccagagagcacaaccaagaga
tcccccagcgccaaaggcgcttctgagccagagcgaagcttgcggaaggggagaccagcc
ttggccagccaggagtcctctctttccagtacctccccttcttctcccgttcccgtgaaa
gtgtccgtaaagccctcccgctcccgaagcaaagccgattcttcctccagggccagtgga
cagcattcctcccctgcccctgccccaaagaaggagtcctcccccaagtcccacgagtct
gtgtcgtccccttcgctccagaagcagaagtcggcttcttccctcgcttatactgcttcc
tccacgtctgccaagaaagcctcaggccccaccccgaggggccccttccctcctgggaag
agcaggacttcagacaggagcttaagccgagagggctccagacacagcctggtttccgac
agggccagcgtcacctccagctccaaacccaactccccgcgcgtgagccaggccagggcc
ggagacggcagggcagacagcaggcacgtgcggagctcctccatggccagcctgcgctcc
cccagcacgagcgtgagggccggcctgaagagggacagcaaatccgaggacaaggggctg
tccttcttcaagtcggccttgagacagaaggagacccggcggtcgacggatctgggcaag
accagcttgctgtccaagaaggcgggcggggggtccgtcaagtcagtctgtaagagcgcg
gtggatgacaaggcagagaaaggctcccaggcgccaggctcccagcagccaaatgccatt
gcagttgggaaagagccgcttgcctccaaggacccctcttctggtaaacattccctgctg
tccactcgcaagtccaagacttcccagctcgattctgcagcgccctcgtctcctgggtgc
aggcagtctgctgagaaatcctccaaaaagttaccttctagcatgcaaacctctgcacgg
ccttctcagaaacctcagtga

DBGET integrated database retrieval system