KEGG   Bos taurus (cow): 786974Help
Entry
786974            CDS       T01008                                 

Definition
(RefSeq) beta-hexosaminidase subunit beta
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
bta  Bos taurus (cow)
Pathway
bta00511  Other glycan degradation
bta00520  Amino sugar and nucleotide sugar metabolism
bta00531  Glycosaminoglycan degradation
bta00603  Glycosphingolipid biosynthesis - globo and isoglobo series
bta00604  Glycosphingolipid biosynthesis - ganglio series
bta01100  Metabolic pathways
bta04142  Lysosome
Module
bta_M00079  Keratan sulfate degradation
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    786974
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    786974
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    786974
   00604 Glycosphingolipid biosynthesis - ganglio series
    786974
   00511 Other glycan degradation
    786974
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    786974
Enzymes [BR:bta01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     786974
Chaperones and folding catalysts [BR:bta03110]
 Intramolecular chaperones
  Others
   786974
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_20 Glycohydro_20b2 Glyco_hydro_20b YozE_SAM_like
Motif
Other DBs
NCBI-GeneID: 786974
NCBI-ProteinID: XP_015314536
BGD-bta: BT29952
Position
20
AA seq 587 aa AA seqDB search
MEQRGLGRLRLPGLLALLAGLVVQAALGTRRTQTPRLSASRDLNLWPLPLSVMTTPRLLY
LSPRNDFFGHSPTSKAGPSCAVLQEAFRRYYDYIFGFYKWPLGSDNIPREMELQKLEVSV
IMDPECDSFPSITSDESYTLLVKGPVATLTANRVWGVLRGLETFSQLIYQDSYGTFTANE
SNIVDSPRFPHRGILIDTSRHFLPVKTILKTLDAMAFNKFNVLHWHIVDDQSFPYQSISF
PELSNKVSNSCYCCWCTKIFGMVSLEVGSLNVSYYGYNLSVKVRYSWLKIFNTLLLSILG
PQNWSAFVIVIINVNIYGNYYFRKDSPCFLLGQEDLLTPCYHAREPSGTFGPINPILNST
YSFLSKLFKEISTVFPDEFIHLGGDEVNFNCWKSNPAVLRFMRNKRFGKIEKLQSFYMQM
VLDMISAMKKRSIVWQEVYDDEGELTPGTVVQVWKKQNFPMKLSQVTAAGFPVILSAPWY
LDLISYGEDWRQYYSVKPLNFAGTPEQKQLVIGGEACIWGEYVDATNLTPRLWPRASAVG
ERLWSHQEVTDLEDAYRRLTRHRCRMVGRGIAAQPLFTGYCEHEGGM
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atggagcaacgcgggctggggaggctgaggctacccgggctgctggcgctgctggcgggg
ctggtagtgcaggcggcgctggggacgcgaaggacgcagaccccgcgcctctctgcttcg
cgggacctgaatctttggcccctgcctctctctgtgatgacgaccccgcgcttgctttat
ctctcacccagaaacgacttcttcgggcacagccccacttccaaggctggcccctcctgc
gcagtcctgcaggaagcgtttcggcgatattatgactatatttttggtttctacaagtgg
cctcttggctctgataatattccaagggaaatggagttacagaaacttgaagtctcagtc
atcatggacccagagtgtgacagtttccccagcatcacttcggatgagtcttatacttta
ctggtgaaaggaccagtggccacgctcactgccaacagagtttggggagtattacgaggt
ttagagacctttagccagttgatttaccaagattcttacgggactttcactgccaatgaa
tccaacattgtggattctcccaggtttcctcatagaggaatcttaattgatacatctaga
cactttctgcccgttaagactattttgaaaactctggatgccatggcttttaataagttt
aatgttctccactggcacatagtggatgaccagtctttcccttatcagagcatcagtttt
cctgaattaagcaataaagtgagtaattcatgttattgttgttggtgtacaaaaattttt
ggtatggtttccttagaagttggtagcttaaatgtttcttattatggatataatttaagt
gtaaaagttagatattcgtggttaaaaatttttaatacgctattgctgagcattttaggt
ccacaaaactggtctgcttttgtaattgttatcataaatgtaaacatttatgggaactac
tacttcagaaaagattctccgtgtttccttctaggccaggaagacctcctgactccatgt
tatcatgcgagagagccatctgggacttttggacctataaaccctatattgaattcaact
tacagcttcctgtctaaacttttcaaagaaattagtactgtgtttccagatgaattcatt
catctgggaggagatgaagtaaattttaattgttggaagtccaatccagcagtcctgcgt
ttcatgaggaacaaacgctttggcaaaattgagaaactacaatctttctatatgcagatg
gttttggatatgatttcagccatgaagaagagatccatagtctggcaagaggtttatgat
gatgaaggcgagcttacaccaggcacagtagttcaagtgtggaaaaagcagaactttcct
atgaaactaagtcaagttacagcagctggcttccctgtgatcctttctgctccttggtac
ttagatttgatcagttatggagaagactggagacagtactactctgtgaagcctcttaac
tttgcgggtactccggaacagaaacagctcgtcattggtggagaagcctgcatatgggga
gagtatgtggatgcaactaaccttactccaagattatggcctcgggcgagtgctgttggt
gagagactctggagtcaccaagaagtcacagacctagaggatgcttacaggaggctaaca
agacaccgctgcagaatggtcggaagaggaatagctgcacaacctctctttactggatat
tgtgagcatgagggcggaatgtaa

DBGET integrated database retrieval system