KEGG   Bos taurus (cow): 787278Help
Entry
787278            CDS       T01008                                 

Gene name
MAP2K7
Definition
(RefSeq) mitogen-activated protein kinase kinase 7
  KO
K04431  mitogen-activated protein kinase kinase 7 [EC:2.7.12.2]
Organism
bta  Bos taurus (cow)
Pathway
bta04010  MAPK signaling pathway
bta04012  ErbB signaling pathway
bta04141  Protein processing in endoplasmic reticulum
bta04380  Osteoclast differentiation
bta04530  Tight junction
bta04620  Toll-like receptor signaling pathway
bta04660  T cell receptor signaling pathway
bta04664  Fc epsilon RI signaling pathway
bta04668  TNF signaling pathway
bta04722  Neurotrophin signaling pathway
bta04912  GnRH signaling pathway
bta04926  Relaxin signaling pathway
bta05164  Influenza A
bta05167  Kaposi's sarcoma-associated herpesvirus infection
bta05169  Epstein-Barr virus infection
bta05418  Fluid shear stress and atherosclerosis
Module
bta_M00688  MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:bta00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    787278 (MAP2K7)
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    787278 (MAP2K7)
   04012 ErbB signaling pathway
    787278 (MAP2K7)
   04668 TNF signaling pathway
    787278 (MAP2K7)
 Cellular Processes
  Cellular community - eukaryotes
   04530 Tight junction
    787278 (MAP2K7)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    787278 (MAP2K7)
   04660 T cell receptor signaling pathway
    787278 (MAP2K7)
   04664 Fc epsilon RI signaling pathway
    787278 (MAP2K7)
  Endocrine system
   04912 GnRH signaling pathway
    787278 (MAP2K7)
   04926 Relaxin signaling pathway
    787278 (MAP2K7)
  Nervous system
   04722 Neurotrophin signaling pathway
    787278 (MAP2K7)
  Development
   04380 Osteoclast differentiation
    787278 (MAP2K7)
 Human Diseases
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    787278 (MAP2K7)
  Infectious diseases
   05164 Influenza A
    787278 (MAP2K7)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    787278 (MAP2K7)
   05169 Epstein-Barr virus infection
    787278 (MAP2K7)
Enzymes [BR:bta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     787278 (MAP2K7)
Protein kinases [BR:bta01001]
 Serine/threonine kinases: STE group
  STE7 family
   787278 (MAP2K7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase Seadorna_VP7 APH
Motif
Other DBs
NCBI-GeneID: 787278
NCBI-ProteinID: XP_002688882
Position
7
AA seq 410 aa AA seqDB search
FIVVLFFFFFLPFPHPVIVITLSPAPAPSQRAALQLPLANDGGSRSPSSESSPQHPTPPA
RPRHMLGLPSTLFTPRSMESIEIDQKLQEIMKQTGYLTIGGQRYQAEINDLENLGEMGSG
TCGQVWKMRFRKTGHVIAVKQMRRSGNKEENKRILMDLDVVLKSHDCPYIVQCFGTFITN
TDVFIAMELMGTCAEKLKKRMQGPIPERILGKMTVAIVKALYYLKEKHGVIHRDVKPSNI
LLDERGQIKLCDFGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPTKPDYDIRADVWSLG
ISLVELATGQFPYKNCKTDFEVLTKVLQEEPPLLPGHMGFSGDFQSFVKDCLTKDHRKRP
KYNKLLEHSFIKRYETLEVDVASWFKDVMAKTESPRTSGVLSQHHLPFFR
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
tttatcgtggtgttgtttttctttttttttcttccttttccccatccagttattgtgatc
actctaagccctgctcctgccccgtcccaacgagcagccctgcagctcccactggccaac
gatgggggcagccgctcaccgtcctccgagagctccccacagcaccccacgccccccgcc
cggccccgccacatgctggggctgccttcaaccttgttcacaccccgcagcatggagagc
atcgagattgaccagaagctgcaggagatcatgaaacagacgggctacctgaccatcggg
ggccagcgctaccaggcggagatcaatgacctggagaacctgggggagatgggcagcggc
acttgcggccaggtgtggaagatgcgcttccggaagacggggcacgtcatcgctgtcaag
caaatgcggcgctcggggaataaggaggagaacaagaggatcctcatggatttggatgtg
gtgctcaagagccacgactgcccctacattgtgcagtgcttcgggactttcatcaccaat
acggacgtcttcatcgccatggagctcatgggcacgtgcgcggagaagctcaagaagcgg
atgcagggccccatccccgagcggatcctgggcaagatgacggtggcaattgtgaaggcg
ctctactacctgaaggagaagcatggcgtgatccaccgtgacgtcaagccctccaacatc
ctgctggacgagcggggccagatcaagctctgtgacttcggcatcagcggccgcctggtc
gactccaaagccaaaacgcggagtgcgggctgtgccgcctacatggcacctgagcgcatc
gaccccccggatcccaccaagcccgactacgacatccgggccgatgtgtggagcctgggc
atctccttggtggagctggcgacaggacagttcccctacaagaactgcaagacagacttt
gaggtcctcaccaaagtcctccaagaggagcccccgctcctgcccggacacatgggcttc
tcgggggacttccagtccttcgtcaaagactgccttactaaagatcacaggaagagacca
aagtataataagctacttgaacacagcttcatcaagcgctacgagacgctggaggtggat
gtggcgtcctggttcaaggatgtcatggcgaagaccgagtcaccgaggacaagcggggtc
ctgagccagcaccacctgcccttcttcaggtag

DBGET integrated database retrieval system