KEGG   Bos taurus (cow): 787278Help
Entry
787278            CDS       T01008                                 

Gene name
MAP2K7
Definition
mitogen-activated protein kinase kinase 7
Orthology
K04431  
mitogen-activated protein kinase kinase 7 [EC:2.7.12.2]
Organism
bta  Bos taurus (cow)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Protein processing in endoplasmic reticulum
Osteoclast differentiation
Toll-like receptor signaling pathway
T cell receptor signaling pathway
Fc epsilon RI signaling pathway
TNF signaling pathway
Neurotrophin signaling pathway
GnRH signaling pathway
Influenza A
Epstein-Barr virus infection
Module
MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:bta00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    787278 (MAP2K7)
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    787278 (MAP2K7)
   04012 ErbB signaling pathway
    787278 (MAP2K7)
   04668 TNF signaling pathway
    787278 (MAP2K7)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    787278 (MAP2K7)
   04660 T cell receptor signaling pathway
    787278 (MAP2K7)
   04664 Fc epsilon RI signaling pathway
    787278 (MAP2K7)
  Endocrine system
   04912 GnRH signaling pathway
    787278 (MAP2K7)
  Nervous system
   04722 Neurotrophin signaling pathway
    787278 (MAP2K7)
  Development
   04380 Osteoclast differentiation
    787278 (MAP2K7)
 Human Diseases
  Infectious diseases
   05164 Influenza A
    787278 (MAP2K7)
   05169 Epstein-Barr virus infection
    787278 (MAP2K7)
Enzymes [BR:bta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     787278 (MAP2K7)
Protein kinases [BR:bta01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   787278 (MAP2K7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
7
AA seq 410 aa AA seqDB search
FIVVLFFFFFLPFPHPVIVITLSPAPAPSQRAALQLPLANDGGSRSPSSESSPQHPTPPA
RPRHMLGLPSTLFTPRSMESIEIDQKLQEIMKQTGYLTIGGQRYQAEINDLENLGEMGSG
TCGQVWKMRFRKTGHVIAVKQMRRSGNKEENKRILMDLDVVLKSHDCPYIVQCFGTFITN
TDVFIAMELMGTCAEKLKKRMQGPIPERILGKMTVAIVKALYYLKEKHGVIHRDVKPSNI
LLDERGQIKLCDFGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPTKPDYDIRADVWSLG
ISLVELATGQFPYKNCKTDFEVLTKVLQEEPPLLPGHMGFSGDFQSFVKDCLTKDHRKRP
KYNKLLEHSFIKRYETLEVDVASWFKDVMAKTESPRTSGVLSQHHLPFFR
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
tttatcgtggtgttgtttttctttttttttcttccttttccccatccagttattgtgatc
actctaagccctgctcctgccccgtcccaacgagcagccctgcagctcccactggccaac
gatgggggcagccgctcaccgtcctccgagagctccccacagcaccccacgccccccgcc
cggccccgccacatgctggggctgccttcaaccttgttcacaccccgcagcatggagagc
atcgagattgaccagaagctgcaggagatcatgaaacagacgggctacctgaccatcggg
ggccagcgctaccaggcggagatcaatgacctggagaacctgggggagatgggcagcggc
acttgcggccaggtgtggaagatgcgcttccggaagacggggcacgtcatcgctgtcaag
caaatgcggcgctcggggaataaggaggagaacaagaggatcctcatggatttggatgtg
gtgctcaagagccacgactgcccctacattgtgcagtgcttcgggactttcatcaccaat
acggacgtcttcatcgccatggagctcatgggcacgtgcgcggagaagctcaagaagcgg
atgcagggccccatccccgagcggatcctgggcaagatgacggtggcaattgtgaaggcg
ctctactacctgaaggagaagcatggcgtgatccaccgtgacgtcaagccctccaacatc
ctgctggacgagcggggccagatcaagctctgtgacttcggcatcagcggccgcctggtc
gactccaaagccaaaacgcggagtgcgggctgtgccgcctacatggcacctgagcgcatc
gaccccccggatcccaccaagcccgactacgacatccgggccgatgtgtggagcctgggc
atctccttggtggagctggcgacaggacagttcccctacaagaactgcaagacagacttt
gaggtcctcaccaaagtcctccaagaggagcccccgctcctgcccggacacatgggcttc
tcgggggacttccagtccttcgtcaaagactgccttactaaagatcacaggaagagacca
aagtataataagctacttgaacacagcttcatcaagcgctacgagacgctggaggtggat
gtggcgtcctggttcaaggatgtcatggcgaagaccgagtcaccgaggacaagcggggtc
ctgagccagcaccacctgcccttcttcaggtag

DBGET integrated database retrieval system