KEGG   Bos taurus (cow): 787450Help
Entry
787450            CDS       T01008                                 

Gene name
ALOX12E
Definition
arachidonate lipoxygenase, epidermal (EC:1.13.11.31)
Orthology
K00458  
arachidonate 12-lipoxygenase [EC:1.13.11.31]
Organism
bta  Bos taurus (cow)
Pathway
Arachidonic acid metabolism
Metabolic pathways
Serotonergic synapse
Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    787450 (ALOX12E)
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    787450 (ALOX12E)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    787450 (ALOX12E)
Enzymes [BR:bta01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.31  arachidonate 12-lipoxygenase
     787450 (ALOX12E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
19
AA seq 633 aa AA seqDB search
MGKYRIRVATGDSLLAGSSNLVQLWLVGEHGEKDLGKILRPIRIREVQLEVEVSLYLGRL
LLVKLRKHKSLVGFDWFCKWIAVQGPGTQGEAFFPCYRWVQGNEIICLPEGTARTVRDDP
QNQFKKHREKELEERRKVYRWGFWKEGLILPIAGNTQWDLPRNERFLEDKDLDFSLSLAK
VLKDLALKGSLDLTNSVRRLEDFNKVFPQGKTPLAERVRNCWKDDALFGYQFLNGANPML
LRRSTSLPSRLVLPPEMEDLKTQLEKELQTGSLFEADFSLLDGVKPNVIIFKQQYVAAPL
VMLKLQPDGRLLPMVIQLQPPRNGCPPPVLFLPSDPPMAWLLAKTWVRSSDFQLHQLQSH
LLRGHLIAEVISVATMRSLPSLHPIYKVVSTGSGGHVDILQRATAGLTYRSFCPPDDLAD
RGLLDVKSSLYGQDALRLWGVISRYVEKMVSLFYKSDGAVKDDPELQAWCREITETGLQG
AQDRGFPISLESRAQLCHFITMCIFTCTGQHASTHQGQLDWYSWIPNGPCTMQKPPPISK
DVTEKDIVDSLPSLHQARTQKTFIKFLGRRQPVMVALGQHKENYFSDPGPQAVLKQFQEE
LAALDKEIEVRNAGLDLPYEYLRPSMVENSVTI
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaatacaggattcgcgtcgccaccggagactcgctcttggctggctccagcaac
ctagtgcagctgtggctggtgggcgagcacggggagaaggacctggggaagatactgcgg
ccgatacggatcagggaggtgcagctcgaggtcgaagtctccctatacctggggcgcctc
ctgctggtgaagctgcgcaagcacaaaagcctggtgggtttcgactggttctgcaagtgg
atcgcggtccagggtcccggcacccaaggcgaggcctttttcccctgctaccgctgggtg
cagggcaacgagatcatctgcttgcccgagggcaccgcccggaccgtgagggatgatccc
cagaaccagtttaagaaacatcgggagaaagagcttgaggaaagaaggaaggtgtaccga
tggggtttctggaaagagggattaatcctgcctatagcagggaatacacaatgggatctt
cccagaaacgagagatttcttgaagataaggatttagacttcagtctctctctggcaaaa
gtgttgaaggacttggccttaaaggggtcattagatctcacaaattctgtaagaagactg
gaagacttcaataaagtattcccgcaaggaaaaactcctctggctgagcgggtccgcaat
tgctggaaggatgatgccctatttgggtaccagttcctcaacggggcaaaccctatgctc
ctgagacgctccacgagtctcccgtcacggttggtgctgcctccggaaatggaagacttg
aagacacagctggagaaagaactccagactggatctctctttgaagctgacttctccctg
ctggatggggtcaagcctaatgtcatcatttttaagcaacagtatgtagcagcccctctg
gtcatgctgaagctccagcccgatggaagacttttacctatggtcatccagctccagcca
cctcggaatggatgccccccacctgtgttgttcctgccttcggatccccccatggcctgg
ctccttgccaagacctgggtccggagctctgatttccagctccaccagctacagtcacac
ctgctgaggggccacctgatagccgaggttatttctgtggccaccatgaggagcctgccc
agcctgcatcctatctacaaggtggtgagcactgggagtggcggccatgtagacattctc
cagagagccacagctggtctgacctatcgctccttctgccctcctgatgacctggcagac
cgtgggctcctggatgtgaagtcttctctctatggccaagatgcgctcaggctctgggga
gtcatcagccggtacgtagagaagatggtcagtcttttctacaagagtgatggagctgtg
aaggatgatccagaactgcaggcctggtgtagagagatcactgagactggactgcagggg
gctcaggaccgggggttccctatctccttagagtcccgagctcagctctgccacttcatc
accatgtgcatcttcacgtgcactggtcagcatgcttccacccaccagggccagctggac
tggtactcctggatcccgaatggtccatgcaccatgcagaagcctccgcccatctccaag
gatgtgacagagaaggatatagtagactcactgcctagtctgcaccaggcccgaacacag
aagacattcataaaattccttggccgacgccagcctgtcatggtggccttggggcagcac
aaagaaaactatttctctgaccctggacctcaagctgtgctgaagcaattccaggaggag
ttggctgccctggacaaggagattgaggtccgaaatgcaggcctggacctgccctatgag
tatcttcgacccagcatggtagagaacagtgtgaccatttga

DBGET integrated database retrieval system