KEGG   Bos taurus (cow): 787450Help
Entry
787450            CDS       T01008                                 

Gene name
ALOX12E
Definition
(RefSeq) arachidonate lipoxygenase, epidermal
  KO
K00458  
arachidonate 12-lipoxygenase [EC:1.13.11.31]
Organism
bta  Bos taurus (cow)
Pathway
Arachidonic acid metabolism
Metabolic pathways
Antifolate resistance
Serotonergic synapse
Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    787450 (ALOX12E)
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    787450 (ALOX12E)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    787450 (ALOX12E)
 Human Diseases
  Drug resistance
   01523 Antifolate resistance
    787450 (ALOX12E)
Enzymes [BR:bta01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.31  arachidonate 12-lipoxygenase
     787450 (ALOX12E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
19
AA seq 633 aa AA seqDB search
MGKYRIRVATGDSLLAGSSNLVQLWLVGEHGEKDLGKILRPIRIREVQLEVEVSLYLGRL
LLVKLRKHKSLVGFDWFCKWIAVQGPGTQGEAFFPCYRWVQGNEIICLPEGTARTVRDDP
QNQFKKHREKELEERRKVYRWGFWKEGLILPIAGNTQWDLPRNERFLEDKDLDFSLSLAK
VLKDLALKGSLDLTNSVRRLEDFNKVFPQGKTPLAERVRNCWKDDALFGYQFLNGANPML
LRRSTSLPSRLVLPPEMEDLKTQLEKELQTGSLFEADFSLLDGVKPNVIIFKQQYVAAPL
VMLKLQPDGRLLPMVIQLQPPRNGCPPPVLFLPSDPPMAWLLAKTWVRSSDFQLHQLQSH
LLRGHLIAEVISVATMRSLPSLHPIYKVVSTGSGGHVDILQRATAGLTYRSFCPPDDLAD
RGLLDVKSSLYGQDALRLWGVISRYVEKMVSLFYKSDGAVKDDPELQAWCREITETGLQG
AQDRGFPISLESRAQLCHFITMCIFTCTGQHASTHQGQLDWYSWIPNGPCTMQKPPPISK
DVTEKDIVDSLPSLHQARTQKTFIKFLGRRQPVMVALGQHKENYFSDPGPQAVLKQFQEE
LAALDKEIEVRNAGLDLPYEYLRPSMVENSVTI
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaatacaggattcgcgtcgccaccggagactcgctcttggctggctccagcaac
ctagtgcagctgtggctggtgggcgagcacggggagaaggacctggggaagatactgcgg
ccgatacggatcagggaggtgcagctcgaggtcgaagtctccctatacctggggcgcctc
ctgctggtgaagctgcgcaagcacaaaagcctggtgggtttcgactggttctgcaagtgg
atcgcggtccagggtcccggcacccaaggcgaggcctttttcccctgctaccgctgggtg
cagggcaacgagatcatctgcttgcccgagggcaccgcccggaccgtgagggatgatccc
cagaaccagtttaagaaacatcgggagaaagagcttgaggaaagaaggaaggtgtaccga
tggggtttctggaaagagggattaatcctgcctatagcagggaatacacaatgggatctt
cccagaaacgagagatttcttgaagataaggatttagacttcagtctctctctggcaaaa
gtgttgaaggacttggccttaaaggggtcattagatctcacaaattctgtaagaagactg
gaagacttcaataaagtattcccgcaaggaaaaactcctctggctgagcgggtccgcaat
tgctggaaggatgatgccctatttgggtaccagttcctcaacggggcaaaccctatgctc
ctgagacgctccacgagtctcccgtcacggttggtgctgcctccggaaatggaagacttg
aagacacagctggagaaagaactccagactggatctctctttgaagctgacttctccctg
ctggatggggtcaagcctaatgtcatcatttttaagcaacagtatgtagcagcccctctg
gtcatgctgaagctccagcccgatggaagacttttacctatggtcatccagctccagcca
cctcggaatggatgccccccacctgtgttgttcctgccttcggatccccccatggcctgg
ctccttgccaagacctgggtccggagctctgatttccagctccaccagctacagtcacac
ctgctgaggggccacctgatagccgaggttatttctgtggccaccatgaggagcctgccc
agcctgcatcctatctacaaggtggtgagcactgggagtggcggccatgtagacattctc
cagagagccacagctggtctgacctatcgctccttctgccctcctgatgacctggcagac
cgtgggctcctggatgtgaagtcttctctctatggccaagatgcgctcaggctctgggga
gtcatcagccggtacgtagagaagatggtcagtcttttctacaagagtgatggagctgtg
aaggatgatccagaactgcaggcctggtgtagagagatcactgagactggactgcagggg
gctcaggaccgggggttccctatctccttagagtcccgagctcagctctgccacttcatc
accatgtgcatcttcacgtgcactggtcagcatgcttccacccaccagggccagctggac
tggtactcctggatcccgaatggtccatgcaccatgcagaagcctccgcccatctccaag
gatgtgacagagaaggatatagtagactcactgcctagtctgcaccaggcccgaacacag
aagacattcataaaattccttggccgacgccagcctgtcatggtggccttggggcagcac
aaagaaaactatttctctgaccctggacctcaagctgtgctgaagcaattccaggaggag
ttggctgccctggacaaggagattgaggtccgaaatgcaggcctggacctgccctatgag
tatcttcgacccagcatggtagagaacagtgtgaccatttga

DBGET integrated database retrieval system