KEGG   Bos taurus (cow): 787581Help
Entry
787581            CDS       T01008                                 

Gene name
H2B
Definition
histone H2B
Orthology
K11252  
histone H2B
Organism
bta  Bos taurus (cow)
Pathway
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:bta00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    787581 (H2B)
  Immune diseases
   05322 Systemic lupus erythematosus
    787581 (H2B)
  Substance dependence
   05034 Alcoholism
    787581 (H2B)
Exosome [BR:bta04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   787581 (H2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
23
AA seq 67 aa AA seqDB search
MGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAV
TKYTSSK
NT seq 204 nt NT seq  +upstreamnt  +downstreamnt
atgggaatcatgaactctttcgtcaacgacattttcgagcgcatcgcaggcgaggcatcg
cgcctggcgcattacaacaagcgttcgactatcacatccagagagatccagaccgccgtg
cgcttgctgctacctggggagctggccaagcacgccgtgtccgagggcactaaggctgtt
accaagtataccagctccaagtaa

DBGET integrated database retrieval system