KEGG   Bos taurus (cow): 788978Help
Entry
788978            CDS       T01008                                 

Gene name
ARHGAP5
Definition
(RefSeq) Rho GTPase activating protein 5
  KO
K13709  
Rho GTPase-activating protein 5
Organism
bta  Bos taurus (cow)
Pathway
Focal adhesion
Leukocyte transendothelial migration
Brite
KEGG Orthology (KO) [BR:bta00001]
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    788978 (ARHGAP5)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    788978 (ARHGAP5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
21
AA seq 1413 aa AA seqDB search
MMAKNKEPRPPSYTISVVGLSGTEKDKGNCGVGKSCLCNRFVRSKADEYYPEHTSVLSTI
DFGGRVVNNDHFLYWGDITQSGEDGVECKIHVIEQTEFIDDQTFLPHRSTNLQPYIKRAA
ASKLQSAEKLMYICTDQLGLEQDFEQKQMPEGKLNVDGFLLCIDVSQGCNRKFDDQLKFV
NNLFVQLSKSKKPVIIAATKCDECVDHYLREVQAFASNKKNLLVVETSARFNVNIETCFT
ALVQMLDKTRGKPKIIPYLDAYKTQRQLVVTATDKFEKLVQTVRDYHATWKTVSNKLKNH
PDYEEYINLEGTRKARNTFSKHIEQLKQEHIRKRREEYINTLPRAFNTLLPNLEEIEHLN
WSEALKLMEKRADFQLCFVVLEKTPWDETDHIDKINDRRIPFDLLSTLEAEKVYQNHVQH
LISEKRRVEMKEKFKKTLEKIQFISPGQPWEEVMCFVMEDEAFKYITEADSKEVYGRHQR
EIVEKAKEEFQEMLFEHSELFYDLDLNATPSSDKMSEIHTVLSEEPRYKALQKLAPDRES
LLLKHIGFVYHPTKETCLSGQNCTDIKVEQLLASSLLQLDHGRLRLYHDSTNIDKVNLFI
LGKDGLAQELANEIRTQSTDDEYALDGKIYELDLRPVDAKSPYFLSQLWTAAFKPHGCFC
VFNSIESLNFIGEFIGKIRTEASQIRKDKYMANLPFTLILANQRDSISKNLPILRHQGQQ
LANKFLMLDKIIGEKRRRIQITILSYHSSIGVRKDELVHGYILVYSAKRKASMGMLRAFL
SEVQDTIPVQLVAVTDSQADFFENEAIKELMTEGEHIATEISAKFTALYSLSQYHRQTEV
FTLFFSDVLEKKNMIENSYLSDSTRESTHQSEDVFLPSPRDCFPYNNYPDSDDDTEAPPP
YSPIGDDVQLLPTPSDRSRYRLDLEGNEYPIHSTPNCHDHERNHKVPPPIKPKPVAPKTN
VKKLDPNLLKTIEAGIGKNPRKQTSRVPLAHPEDMDPSDNYSEPIDTIFKQKGYSDEIYV
VPDDSQNRVIKIRNSFVNNTQGDEENGFSDRTSKSHGERRPSKYKYKSKTLFSKAKSYYR
RTHSDASDDEAFTTSKTKRKGRHRGSEEDPLLSPVETWKGGIDNPAITSDQELDDKKMKK
KTHKVKEDKKQKKKTKNFNPPTRRNWESNYFGMPLQDLVTAEKPIPLFVEKCVEFIEDTG
LCTEGLYRVSGNKTDQDNIQKQFDQDHNISLVSMEVTVNAVAGALKAFFADLPDPLIPYS
LHPELLEAAKILDKAERLHALKEIVKKFHPVNYDVFRYIITHLNRVSQHNKVNLMTADNL
SICFWPTLMRPDFENREFLSTTKIHQSVVETFIQQCQFFFYNGEIVETANTVAPAPPSNP
GQLVEPMVPLQLPPPLQPQLIQPQLQTDPLGII
NT seq 4242 nt NT seq  +upstreamnt  +downstreamnt
atgatggcaaaaaacaaagagcctcgccccccgtcctataccatcagtgtagttggactc
tctgggactgaaaaagacaaaggtaactgtggagttggaaagtcttgtttgtgcaataga
tttgtacgctcaaaagctgatgaatattatccagaacatacttctgtgcttagcaccatt
gacttcggaggacgagtagtaaacaatgatcattttttgtactggggtgacataacgcaa
agtggtgaagatggagtagagtgcaaaattcatgtcatcgaacaaactgagttcattgat
gaccagactttcttgcctcatcggagtacgaatttgcaaccatatataaagcgtgcagct
gcctctaaattgcagtcagcagaaaaactaatgtacatttgcactgatcaactaggcttg
gaacaagacttcgaacagaagcaaatgcctgaagggaagctcaatgtagatggattttta
ttgtgcattgacgtaagtcagggatgcaataggaagtttgatgatcaacttaaatttgtg
aataacctttttgtccaactatcaaaatcaaaaaaacctgtaataatagcagcaactaaa
tgtgatgaatgtgtggatcattatcttagagaagttcaggcatttgcttcaaacaaaaag
aaccttcttgtagtggaaacatcagcacgatttaacgtcaacattgagacatgtttcact
gcactggtacaaatgttggataaaactcgtggcaagcctaaaattattccctatctggat
gcttataaaacacagagacaacttgttgtcacagcaacagataagttcgaaaaacttgta
cagactgtaagagattatcatgcaacttggaaaactgttagtaacaaattgaaaaatcat
cctgattatgaagaatacatcaacttagagggaacaagaaaggctagaaatacattctca
aaacacatagaacagcttaaacaggaacatataagaaaaaggagagaagaatatataaat
actttaccgagagcttttaacactcttttgccaaatctggaagagattgaacatttgaat
tggtcagaagctttgaagttaatggaaaagagagcagattttcagttatgttttgtggtg
ctagaaaaaacaccttgggatgaaactgaccatatagacaaaatcaacgatagacggatc
ccatttgacctcctgagcactttagaagctgaaaaagtctatcagaaccatgtacagcat
ctaatatcagagaagaggagggtagaaatgaaggaaaaattcaagaagactttggaaaaa
attcagtttatttcacctgggcaaccatgggaggaagttatgtgttttgtaatggaggat
gaagccttcaaatacatcactgaggctgatagcaaagaggtgtatggtaggcatcagcga
gaaatagttgaaaaagccaaagaagagtttcaggaaatgctttttgaacattctgaactt
ttttatgatttagatcttaatgcaacacctagttcagataaaatgagtgaaattcataca
gttttgagtgaagaacctagatataaagctttacagaaacttgcaccggatagggagtct
cttctacttaagcatataggatttgtttatcatcccactaaagaaacatgtcttagtggc
caaaactgtacagacattaaagtagagcagttacttgccagtagtcttttgcagttggat
catggtcgcttacggttgtatcatgatagcaccaatatagataaagttaaccttttcatt
ttagggaaagatggccttgcccaagaactagcaaatgagataaggacacaatccactgac
gatgagtatgccttagatggaaaaatttatgaacttgatcttcggcctgttgatgccaag
tcgccttactttttaagtcagttgtggactgctgcctttaaaccacatgggtgcttttgt
gtatttaattccattgagtcactgaattttattggggagtttattggaaaaataagaact
gaagcttctcagatcagaaaagataagtatatggccaaccttccatttacattaattctg
gctaatcagagagattctattagtaagaatctaccaattctcaggcaccaagggcaacag
ttggcaaacaaattcctaatgcttgataaaatcattggtgaaaaaaggaggcgaatacag
atcacaatattatcataccattcctcaattggagtaaggaaagatgaactggttcatggt
tatatactagtgtattctgccaaacggaaagcatcaatgggaatgcttcgagcatttctg
tcagaggttcaggacaccatccctgtacaactggtggcagttactgacagccaagcagac
ttttttgaaaatgaggccatcaaggagttaatgactgaaggagaacacattgcaactgag
atctctgctaaatttacagcattgtattctttatctcagtatcatcggcaaactgaggtc
tttacactgtttttcagtgatgttctagagaaaaaaaatatgatagaaaattcctattta
tctgatagtacaagggaatcaacccatcagagtgaagatgttttcctgccatctcccaga
gactgttttccctacaacaactaccctgattcagatgatgatacagaagcaccacctcct
tatagtccaattggggatgatgtacagctgcttccaacacctagtgaccgatccagatat
agattagatttggaaggaaatgaataccctattcacagcaccccgaattgtcatgaccat
gaacgcaaccataaagtgcctccacctattaaacctaaaccagttgcaccgaagacaaac
gtgaaaaaattggatccaaaccttttaaaaacaattgaagctggtattggtaaaaatcca
agaaaacagacttctcgggtgcctttggcacatcccgaagatatggatccttcagataac
tattcagaacctattgacacaattttcaaacagaagggctattctgatgagatatacgtt
gtcccagatgacagtcagaatcgtgttattaaaattagaaactcatttgtaaataacacc
caaggagatgaagaaaatggattttccgatagaacctcgaaaagtcatggagaacggagg
ccttcaaaatacaaatataaatctaaaaccctgtttagtaaagccaagtcatactacaga
agaacacattcagatgcaagtgatgatgaggctttcacgacttctaaaacgaaaagaaaa
ggaagacatcgtggaagtgaggaagatccacttctttctcctgttgaaacttggaaaggt
ggtattgataatcctgcaatcacttcagatcaagagttagatgataagaaaatgaagaag
aaaacccacaaagtgaaagaagacaaaaaacagaaaaagaaaactaagaacttcaatcca
ccaacacgtagaaattgggaaagtaattactttgggatgcccctccaggatctggttaca
gctgagaagcctataccactgtttgttgaaaaatgtgtggaatttattgaagatacagga
ttatgtactgaaggactctaccgtgttagtgggaacaaaactgatcaagacaatattcaa
aagcagtttgatcaagatcataatatcagtctagtatcaatggaagtaacagtaaatgct
gtagctggagctcttaaagctttctttgcagatctaccagatcctttaattccatattct
cttcatccagagctactggaagcagcaaaaatcctggataaagcagaacgtcttcatgca
ctgaaagaaattgttaagaaatttcatcctgttaactatgatgtattcagatatataata
acacatctaaacagggtcagtcaacataataaagtcaacttaatgacagcagacaactta
tccatctgtttttggccaactttgatgagacctgattttgaaaatcgagaatttctgtct
accaccaagatccatcaatccgttgttgaaacattcattcaacagtgtcagtttttcttt
tacaatggagaaattgtggaaactgcaaacactgtggctccagcgccaccttcaaaccca
ggacagttggtagaaccaatggtaccacttcagttaccaccaccattgcaacctcagctg
atacaaccacagttacagacggatcctcttggtattatataa

DBGET integrated database retrieval system