KEGG   Bos taurus (cow): 789329Help
Entry
789329            CDS       T01008                                 

Gene name
USP17L5
Definition
ubiquitin specific peptidase 17-like 5
Orthology
K11845  
ubiquitin carboxyl-terminal hydrolase 17 [EC:3.4.19.12]
Organism
bta  Bos taurus (cow)
Brite
Enzymes [BR:bta01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     789329 (USP17L5)
Peptidases [BR:bta01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   789329 (USP17L5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Position
3
AA seq 473 aa AA seqDB search
MGALSRQAADRATCGGVAFGKEVDVLREGAGPPPQVAPQTRRLRVEREEPRFLGHREPLL
PLAHPATSQRRRGPLRVGVVGPAPLVRMPFGDPLSLRAVPALRRPSGTPAEDAHEFLMFT
LNAMQQGCLSASQPSGHASEDTTVIRQIFGGTWRSQIQCLRCLGVSDTFDPYLDISLDIT
AAQSVEQALRELVKPEKLDADNAYDCGVCLRKVPATKRLTLHSTSQVLVLVLKRFTPVSG
AKRAQEVRYPQCLDLQPYTSERKAGPLGYVLYAVLVHSGWSCERGHYFCYVRAGNGQWYK
MDDAKVTACDETAALSQSAYVLFYAREGAWEGGAGGGAAAPVGADPTDPGQPAGDASGRA
PGSEESPGDTDVEGMSLEQWRRLQEHSRPKPALELRKVQSALPAGAVVIHQSKHGGGRNR
TPPQQEHERLDRPSTDTPPPGPKNVGNGPCAGGRARATKGKNKKPRPSLGLWR
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgggagccctgagcaggcaggcggcagacagagccacctgcgggggtgtggcctttggg
aaggaggtcgacgtcctcagggagggggctggccctccgccgcaggtcgccccgcagacc
cgcagactgagggtggagcgcgaggaaccaaggttcctggggcaccgtgagcccctcctg
cccttggcgcacccggccacctcccaaagacgccgcggtcccttgagggtgggggttgtg
ggcccagcgccgctggtgcggatgcccttcggggaccctctgtccctgagggccgtcccg
gcgcttcggcgtcccagcgggacaccagcagaagatgctcacgagtttctgatgttcact
ctgaatgccatgcagcaagggtgcttgagtgcatcccagccgtcgggtcatgcctccgag
gacaccaccgtcatccgtcagatcttcggcgggacctggaggtctcagatccagtgtctc
cgctgcctcggtgtctcggacacgttcgacccttatctggacatcagcctggatatcacg
gcggctcagagtgtggagcaagctctgagagagctggtgaagcccgagaagctggacgcg
gacaatgcctatgactgtggcgtctgtctccggaaggtgcctgccaccaagaggttgact
ttgcacagcacctcccaggtcctggtgctggtgctgaagcggttcacaccggtgagcggg
gccaaaagggctcaggaggtgcgctatccccagtgcttggacctgcagccctacacgtcc
gagcggaaggcagggccactgggctacgtgctctatgccgtgctggtgcactccgggtgg
agctgtgagcgaggacactacttctgttacgtccgagcgggcaacggccaatggtataag
atggacgatgccaaggtgaccgcctgtgacgagactgctgccctgagccagagcgcctac
gtcctgttctacgcccgggagggtgcgtgggaagggggcgctgggggaggggcagcggcc
cccgtcggggctgaccccacagacccggggcagcctgcaggagacgccagcggcagagct
cctgggtcggaggagtccccgggggacacggacgtcgaagggatgagcttagagcagtgg
cgacgcctgcaagaacacagccgaccgaagccggccttggagctgcggaaggtccagtct
gccctgcctgccggcgcagtcgtgattcaccagtccaaacacggaggagggagaaaccgc
acgccgccccaacaggagcacgagcggctcgaccgtcccagcacggacaccccgcctccg
gggccgaagaacgtcggcaacggcccttgtgccggcgggagggccagagccaccaagggg
aagaacaagaagccgcggccgtctctggggctgtggcggtag

DBGET integrated database retrieval system