KEGG   Bos taurus (cow): 789999Help
Entry
789999            CDS       T01008                                 

Gene name
EIF3B
Definition
eukaryotic translation initiation factor 3, subunit B
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
bta  Bos taurus (cow)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:bta00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    789999 (EIF3B)
Translation factors [BR:bta03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    789999 (EIF3B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
25
AA seq 786 aa AA seqDB search
MQDAENVAAPEAAEQRAEPGPEQAAAEPSPGAEVARPGVQEAAGGEDAEAGPGPEGPAEP
AADGEGKADATPGATPPPPEESSAQLAGEAPAEQAQDAAAEAGSEGAGGDPDGAAEDGGA
DEPSFSDPEDFVDDVSEEELLADVLKDRPQEADGIDSVIVVDNVPQVGPDRLEKLKNVIH
KIFSKFGKITNDFYPEEDGRTKGYIFLEYASPAHALDAVKNADGYKLDKQHTFRVNLFTD
FDKYMTISDEWDIPEKQPFKDLGNLRYWLEEAECRDQYSVIFESGDRTSIFWNDVKDPVS
IEERARWTETYVRWSPKGTYLATFHQRGIALWGGEKFKQIQRFSHQGVQLIDFSPCERYL
VTFSPLMDTQDDPQAIIIWDILTGQKKRGFHCESSAHWPIFKWSHDGKFFARMTLDTLSI
YETPSMGLLDKKSLKISGIKDFSWSPGGNIIAFWVPEDKDIPARVTLMQLPTRQEIRVRN
LFNVVDCKLHWQKNGDYLCVKVDRTPKGTQGVVTNFEIFRMREKQVPVDVVEMKETIIAF
AWEPNGSKFAVLHGEAPRISVSFYHVKNNGKIELIKMFDKQQANTIFWSPQGQFVVLAGL
RSMNGALAFVDTSDCTVMNIAEHYMASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQG
RLLQKNSKDRFCQLLWRPRPPTLLSQDQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVE
RRRTMMEDFRKYRKMAQELYMEQKNARLELRGGVDTDELDSNVDDWEEETIEFFVTEEII
PLGNQE
NT seq 2361 nt NT seq  +upstreamnt  +downstreamnt
atgcaggacgcggagaacgtggcggcgcccgaggcggccgagcagcgcgccgagcccggg
ccggagcaggcggcagccgagccgtcgccaggggcggaggtggcgcggcccggcgtgcag
gaggcggcgggcggcgaggacgcggaggccgggccggggcctgagggtccggctgagccc
gcggccgacggggaagggaaggccgacgcgacccccggcgccaccccgccgccgcccgag
gagtcctctgcccagctcgccggcgaggccccggcggagcaggcgcaggacgcggcggcc
gaggccgggtccgagggggcgggcggggatccggacggcgcggcggaggacggcggcgcg
gacgagccctccttcagcgatcccgaggacttcgtggacgacgtgagcgaggaagagtta
ctggcggatgtgctcaaagaccggccgcaggaagcggacggaatcgactcggtgatcgtg
gtcgacaacgtgcctcaggtggggcccgaccgcctggagaagctcaaaaatgtcatccat
aagatcttctccaagtttgggaaaatcacaaacgatttctatccagaggaggacggaagg
acaaaagggtatattttcctggaatacgcatcccctgcccacgcgttggacgccgtgaaa
aatgccgatggttacaagctcgacaagcagcacacgttcagggtcaacctcttcaccgat
tttgacaagtacatgaccatcagtgatgaatgggatattccagagaaacaacctttcaaa
gacctggggaacctgcgctactggcttgaagaggctgagtgcagagatcagtacagcgtg
atcttcgagagcggggaccgcacttccatattctggaatgatgtgaaggacccagtctcc
atcgaggagagagcgcgatggacagagacatacgtgcgttggtctcctaagggcacctac
ctggccacctttcaccagcgaggcattgctctgtgggggggagagaaattcaaacagatt
cagagattcagccaccaaggggttcagcttatcgatttctcaccttgtgaaaggtacctg
gtgaccttcagccccctgatggacactcaggatgaccctcaggccatcatcatctgggac
atcctcaccggtcagaagaagagaggtttccactgtgagagctcagcccactggcctatc
tttaagtggagccacgatggtaaattttttgccagaatgacactcgatactctgagtatc
tatgaaactccttctatgggtctcttggacaagaagagcttgaagatctctggcataaaa
gatttttcttggtcccctggtggtaacataatagccttttgggtgcctgaagataaagat
attccagcccgggtaaccctgatgcagctgcctaccagacaagagatcagagttaggaac
ctgttcaacgttgtggattgcaagctgcattggcagaaaaacggagattacttgtgtgtt
aaagtagacaggactccaaaaggcacccagggtgttgtcacaaattttgaaattttccga
atgcgagaaaaacaggtgcctgtcgacgtggtcgagatgaaagaaaccatcattgccttc
gcctgggagccgaacggaagtaagtttgctgtgctgcacggggaggcgcctcggatatct
gtctccttctaccacgtgaagaacaacgggaaaattgagctcatcaagatgttcgacaag
cagcaggccaacaccatcttctggagcccccaaggacagttcgtcgtgctggctggcctg
cggagcatgaacggcgccttggcgtttgtcgacacctcagactgcacggtcatgaacatc
gcagagcactacatggcctccgacgtggagtgggaccccaccgggcgctatgtcgtcacc
tccgtgtcctggtggagccacaaggtggacaacgcctactggctgtggaccttccaaggc
cgccttctgcagaagaatagcaaggaccgcttctgccagctgctctggaggcctcggccc
cccacgctcctgagccaggatcagatcaagcaaattaaaaaggatctgaagaaatattcc
aagatctttgaacagaaggatcgtttgagccagtccaaagcctcaaaggaattagtggag
agaagacgaaccatgatggaagatttccggaaataccggaaaatggctcaagaactctac
atggagcagaaaaatgcacgactagaattacgcggaggtgtggacaccgacgagctggac
agcaacgtagacgactgggaggaggagaccatcgagttctttgtcacagaagagattatt
ccccttggaaatcaggagtga

DBGET integrated database retrieval system