KEGG   Bos taurus (cow): 790012Help
Entry
790012            CDS       T01008                                 

Gene name
PLCD1
Definition
1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase delta-1-like
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
bta  Bos taurus (cow)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Thyroid hormone signaling pathway
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:bta00562]
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:bta04020]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:bta04070]
Organismal Systems; Endocrine system; Thyroid hormone signaling pathway [PATH:bta04919]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
UniProt: 
Position
22
AA seq 756 aa AA seqDB search
MDSGRDFLTLHGLQDDKDLQALLKGGQLLKVKSNSWRRERFYKLQEDCKTIWQESRKVMR
TPESQLFSIEDIQEVRMGHRTEGLEKFARDVPENRCFSIVFKDQRNTLDLIAPSPADAQH
WVQGLGKIIHHSGSMDQQQKLRHWIHSCLRKADKNKDNKMSFKELQNFLKELNIQVDDSY
ARKIFKECDHSQTDSLEDEEIETFYKILTQRKEIDRTFEEATGSKETLSVDQLVTFLQHQ
QREEEAGPALALSLIERYEPSETAKAQRQMTKDGFLMYLLSADGSAFDLAHRRVYQDMDQ
PLSHYLVSSSHNTYLLEDQLTGPSSTEAYIRALCKGCRCLELDCWDGPNQEPIIYHGYTF
TSKILFCDVVRAIRDYAFKASPYPVILSLENHCSLEQQRVMARHLRTLLGPMLLDRPLDG
VVTSLPSPEQLRGKILLKGKKLGGLFPPGGEGGPEATVVSDEDEAAEMEDEAVRSQVQHK
SKEDKLRLAKELSDMVIYCKSVHFRGFPSSGTSGQAFYEMSSFSENRALRLLQESGNSFV
RHNVNHLSRIYPAGWRTDSSNYSPVEMWNGGCQIVALNFQTPGSEMDVYQGRFLDNGACG
YVLKPAFLRDPNSTFNSRALAHGPWWTPKRLNVRVISGQQLPKVNKNKNSIVDPKVTVEI
HGVSRDVASRQTAVVTNNGFNPWWDTELEFEVAVPELALVRFVVEDYDASSKNDFIGQST
IPLKSLKQGYRHIHLLSKNGDQHPSATLFVKVALQD
NT seq 2271 nt NT seq  +upstreamnt  +downstreamnt
atggactcgggccgggacttcctgaccctgcacggcctacaggatgacaaggacctacag
gcactgctgaagggcggccaactcttgaaggtgaagtccaactcatggcggagagaacgc
ttctacaagctgcaggaggactgcaagaccatctggcaggagtcccgcaaggtcatgagg
accccggaatcccagctgttctccatcgaggacatccaggaggtgcggatggggcaccgc
acagagggcctggagaagtttgctcgggatgtgcctgagaatcgctgcttctccatagtc
ttcaaggaccagcgcaatactctagacctcattgccccatcaccagccgatgcccagcac
tgggtgcagggcctgggcaagatcatccaccactcgggctccatggaccagcagcagaag
ctgcgacactggattcattcctgcttgcgaaaagctgacaaaaacaaggacaacaagatg
agcttcaaagagctacaaaactttctgaaggagctcaacatccaggtggacgacagctat
gcccgaaagatcttcaaggaatgtgaccactctcagacagactccctggaggatgaggag
atagagaccttctacaagatactgacccagaggaaggagatcgaccgcaccttcgaggag
gccacgggctccaaggagaccctgtcggtggatcagttggtgaccttcttgcagcaccag
cagcgggaggaggaggcggggcctgcactggctctctccctcattgagcgctacgaaccc
agtgagacggccaaggcgcagcgtcagatgaccaaggacggctttcttatgtacctgctc
tcggctgacggcagcgccttcgacctggcgcaccggcgcgtctaccaggacatggaccag
ccgctcagccactacctggtgtcgtcctcgcacaacacctacctgctggaagaccagctc
acgggtcccagcagcacagaagcctacatccgggcgctgtgcaaaggctgccgctgcctg
gagctcgactgctgggatgggcccaaccaggagccgatcatctatcatggctacaccttc
acctccaagatcctcttctgcgacgtggtcagggccatccgggactacgccttcaaggca
tccccctaccccgtcatcctgtccttggagaaccactgcagcctggaacagcagcgtgtg
atggcgcgacacctgcgcaccctcctggggcccatgctgttggatcggccattggacggg
gtcgtcaccagcctgccttcccctgagcaactgagggggaagatcttgctgaaggggaag
aagcttggggggctcttcccgcctggaggagaaggtggcccagaggccactgtggtgtca
gacgaggatgaggctgctgagatggaggacgaggcggtgaggagccaagtgcagcacaag
tccaaggaggacaagctcaggctagcgaaggaactctccgacatggtcatttactgcaag
agtgtccactttcggggcttccccagctctggcacctctggacaggctttctatgagatg
tcatccttctctgagaaccgcgccctccgactgctccaagaatcaggaaacagctttgtc
cgccacaacgtgaatcacctgagcaggatctaccccgctgggtggagaacggactcttcc
aactacagccccgtggagatgtggaatgggggctgccagatcgtggccctgaacttccag
actcctgggtcagagatggatgtgtaccagggccgcttcctggacaatggggcctgtggg
tacgtgctgaagcctgccttcctgcgagaccccaactctaccttcaactcccgtgccctg
gcccacgggccctggtggactccgaaacgactcaatgtcagggtcatctcagggcagcag
ctgccaaaagtcaacaagaataagaattcaatcgtggaccccaaggtgacagtggagatc
catggcgtgagccgggacgtggccagccgccagaccgctgtggtcaccaataacggtttc
aatccgtggtgggacacagagttggagtttgaggtggctgtgcctgagcttgcccttgtg
cgctttgtggtggaggactacgatgcctcctccaagaacgacttcattggccagagcacc
atccccttgaaaagcctcaagcagggataccgacacatccacctcctctccaagaacggg
gaccagcacccgtctgccaccctctttgtgaaggtggccctccaggactag

DBGET integrated database retrieval system