KEGG   Bos taurus (cow): 790388Help
Entry
790388            CDS       T01008                                 

Definition
probable G-protein coupled receptor 37-like
Orthology
K04243  
G protein-coupled receptor 37 (endothelin receptor type B-like)
Organism
bta  Bos taurus (cow)
Pathway
Parkinson's disease
Class
Human Diseases; Neurodegenerative diseases; Parkinson's disease [PATH:bta05012]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 277 aa AA seqDB search
MFLLQVASLGVTTFTLCALCIDRFRAATNVQMYYEMIENCSSTTAKLAVIWVGALLLALP
EVVLRQLSKEDLGLSGQAPAERCVIKISPDLPDTIYVLALTYDSARLWWYFGCYFCLPTL
FTITCSLVTARKIRKAEKACTRGNKRQIQLESQMNCTVVALTILYGFCIIPENICNIVTA
YMATGVSQQTMDLLNIISQFLLFFKSCVTPVLLFCLCKPFSRAFMDCCCCCCDECIQKSS
TVTSDDNDNEYTTELELSPFSTIRREMSTFASVGTHC
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgttcctcctgcaggttgcttctctgggagtcactaccttcactttatgcgctctgtgt
atagaccgcttccgggcggccaccaacgtccagatgtactatgaaatgatagaaaactgt
tcttccacaaccgccaaacttgctgtgatatgggtgggcgctctcctgctagccctgcca
gaagtggtgctccgccagttgagtaaggaggacctgggcttgagcgggcaagcgcctgct
gagcgctgcgtcatcaagatctcccccgacctccccgacaccatctatgtcttagccctc
acctacgacagcgctagactctggtggtatttcggctgttacttctgtttgcccacgctt
ttcaccatcacctgctctctagtgactgcaaggaaaatccgcaaagccgagaaagcctgt
acccgggggaataagcgacagatccagctagaaagccagatgaactgtacagtcgtggct
ttgaccattttatatggattttgcattattcctgaaaacatttgcaacattgtgactgct
tacatggccacaggggtttcccagcagacaatggaccttctaaatatcatcagccagttc
cttctgttctttaagtcctgtgtcacccctgtcctcctcttctgtctctgcaaacccttc
agtcgggcctttatggactgctgctgctgctgctgtgacgagtgcattcagaagtcgtcc
acggtgaccagtgatgacaatgacaacgaatacaccacagaactggagctctcacccttc
agtaccatacgccgggaaatgtccacgtttgcttctgttggaactcattgctga

DBGET integrated database retrieval system