KEGG   Bos taurus (cow): 327673Help
Entry
327673            CDS       T01008                                 

Gene name
NDUFA1, CI-MWFE, MWFE
Definition
(RefSeq) NADH:ubiquinone oxidoreductase subunit A1
  KO
K03945  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 1
Organism
bta  Bos taurus (cow)
Pathway
bta00190  Oxidative phosphorylation
bta01100  Metabolic pathways
bta04714  Thermogenesis
bta04723  Retrograde endocannabinoid signaling
bta04932  Non-alcoholic fatty liver disease (NAFLD)
bta05010  Alzheimer's disease
bta05012  Parkinson's disease
bta05016  Huntington's disease
Module
bta_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    327673 (NDUFA1)
 Organismal Systems
  Nervous system
   04723 Retrograde endocannabinoid signaling
    327673 (NDUFA1)
  Environmental adaptation
   04714 Thermogenesis
    327673 (NDUFA1)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    327673 (NDUFA1)
   05012 Parkinson's disease
    327673 (NDUFA1)
   05016 Huntington's disease
    327673 (NDUFA1)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    327673 (NDUFA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MWFE
Motif
Other DBs
NCBI-GeneID: 327673
NCBI-ProteinID: NP_786988
BGD-bta: BT20751
Ensembl: ENSBTAG00000006033
UniProt: Q02377
Structure
PDB: 

Jmol
Position
X
AA seq 70 aa AA seqDB search
MWFEVLPGIAVMGVCLFIPGMATARIHRFSNGGKEKRVAHYPYQWYLMERDRRVSGVNRS
YVSKGLENID
NT seq 213 nt NT seq  +upstreamnt  +downstreamnt
atgtggttcgaggttcttcccgggatcgccgttatgggcgtgtgcttgttcatcccggga
atggccaccgcgcgcatccacaggttcagtaacggcggcaaggaaaaaagggttgcccat
tatccatatcagtggtatttgatggaaagagataggcgcgtctctggagtaaaccgttcc
tatgtgtcaaagggtttggagaacattgattaa

DBGET integrated database retrieval system