KEGG   Bacillus thuringiensis BMB171: BMB171_C0014Help
Entry
BMB171_C0014      CDS       T01239                                 

Definition
(GenBank) deoxyguanosine kinase
  KO
K15519  deoxyadenosine/deoxycytidine kinase [EC:2.7.1.76 2.7.1.74]
Organism
btb  Bacillus thuringiensis BMB171
Pathway
btb00230  Purine metabolism
btb00240  Pyrimidine metabolism
btb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:btb00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BMB171_C0014
   00240 Pyrimidine metabolism
    BMB171_C0014
Enzymes [BR:btb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     BMB171_C0014
    2.7.1.76  2'-deoxyadenosine kinase
     BMB171_C0014
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dNK AAA_18 Cytidylate_kin2 AAA_33 TsaE Thymidylate_kin AAA_28 AAA_29 CbiA PRK RNA_helicase AAA_25 RsgA_GTPase ParA AAA_16 ABC_tran IstB_IS21 AAA MMR_HSR1
Motif
Other DBs
NCBI-ProteinID: ADH04832
Position
complement(22562..23230)
Genome map
AA seq 222 aa AA seqDB search
MNLRQKYDIPNDAVITIAGTVGVGKSTMTTALANALGYRTSFEKVDSNPYLDKFYADFTR
WSFHLQVYFLAERFKEQKRIFEYGGGFVQDRSIYEDTGIFAKMHHEKGTMTETDYETYKG
LFDAMVMTPYFPHPDLLIYLEGSFDDIVDRIQERGRPMEQQTPIEYWKEMHGRYENWINN
FNSCPVLRLNINEYDILKDGDSIEPIIKKIGHFLKQTRKLVK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaaggcaaaaatatgatatacccaatgacgcagtaatcactatcgccggaaca
gtaggtgtgggtaaatcaactatgacaactgcattagctaatgctttaggttatcgcaca
tcatttgaaaaagtagattccaatccatatttggacaagttctatgcggacttcactcgc
tggagcttccacctacaagtgtactttttagcagaacgatttaaggaacaaaaaagaatt
tttgaatatggtggcggttttgttcaagatcgttccatttacgaagacactggaattttc
gcaaagatgcatcatgaaaaaggaacaatgacggaaactgattatgaaacatacaaaggt
ttatttgacgctatggtcatgactccttacttccctcatccagacttattaatttactta
gaaggttctttcgatgatattgtcgatcgtattcaagaacgcgggcgcccaatggaacag
caaacaccaattgagtactggaaagaaatgcatggacgttatgaaaactggattaacaac
tttaattcatgccctgtattacgcttaaatattaatgagtacgatattttaaaagatggt
gattcaatcgaaccaatcataaaaaaaattggccattttttaaaacaaacacgtaaactt
gtaaaataa

DBGET integrated database retrieval system