KEGG   Bacillus thuringiensis BMB171: BMB171_C0067Help
Entry
BMB171_C0067      CDS       T01239                                 

Gene name
folP
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
btb  Bacillus thuringiensis BMB171
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:btb00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
77751..78584
Genome map
AA seq 277 aa AA seqDB search
MKWDYDLRCGEYTLNLNEKTLIMGILNVTPDSFSDGGSYNEVDAAVRHAKEMQGQGAHII
DIGGESTRPGFAKVSVEEEIKRVVPMIQAVSKEVKLPISIDTYKAEVAKQAIEAGAHIIN
DIWGAKAEPKIAEVAAHYDVPIILMHNRDNMNYRNLMADMIADLYDSIKIAKNAGVPDEN
IILDPGIGFAKTPEQNLEAMRNLEQLNVLGYPVLLGTSRKSFIGHVLDLPVEERLEGTGA
TVCLGIEKGCEFVRVHDVKEMARMAKMMDAMIGKGVR
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
ttgaagtgggattatgatttgcgctgcggcgaatatacattgaatttaaatgaaaaaaca
ttaattatggggattttaaatgtaacaccagattcgttttctgatggtgggagttacaac
gaggtagatgctgcggtacgtcacgcaaaagaaatgcaaggtcaaggtgctcatattatt
gatattggtggcgaatctactcgcccaggttttgctaaagtatcagtagaagaagaaata
aagcgagttgtcccgatgattcaagcagtttcaaaagaagtaaaattgcctatatctatc
gatacatataaagctgaagttgcaaagcaagcaattgaggctggtgctcatattattaat
gatatttggggagcgaaggcggagccaaaaattgctgaagtcgcagctcattatgatgta
cccatcattttaatgcataaccgtgataatatgaattatcgtaatttaatggcggatatg
attgctgatttgtatgacagtattaaaattgctaaaaatgctggtgtgccagatgagaat
attattttagatccaggtatcggttttgctaaaacacctgagcagaacttagaggcgatg
cgtaatttagaacagttaaatgtgctaggttatccagttctcttaggtacttcgagaaag
tcctttattgggcacgtattagatttgccagtggaggaacgccttgagggaacaggagct
accgtttgtcttggtattgaaaagggctgtgagtttgttcgtgtccatgatgtgaaagaa
atggcgcgtatggctaaaatgatggatgcgatgattggtaagggggtaaggtaa

DBGET integrated database retrieval system