KEGG   Bacillus thuringiensis BMB171: BMB171_C0275Help
Entry
BMB171_C0275      CDS       T01239                                 

Gene name
purN
Definition
phosphoribosylglycinamide
Orthology
K11175  
phosphoribosylglycinamide formyltransferase 1 [EC:2.1.2.2]
Organism
btb  Bacillus thuringiensis BMB171
Pathway
Purine metabolism
One carbon pool by folate
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:btb00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BMB171_C0275 (purN)
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    BMB171_C0275 (purN)
Enzymes [BR:btb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.2  phosphoribosylglycinamide formyltransferase
     BMB171_C0275 (purN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
327100..327687
Genome map
AA seq 195 aa AA seqDB search
MSRLAVFASGSGSNFQSLVNAVEEKRLDAEISLLVCDKPEARAVGRANYHHIPCFAFSAK
AYESKEAFEKEILKKLEEYEIDYVILAGYMRLIGPTLLEAYGGKIINIHPSLLPSFPGKD
AVGQALEAGVKVTGVTIHYVDAGMDTGPIIAQEAVVVSEGDTRESLQKKIQQVEHKLYVN
TVNQIVQSVKESTVN
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgagtagattagcagtttttgcttctggaagcggatctaactttcaatctctcgttaat
gcggtagaagaaaaaagattggatgcagaaattagtttattagtatgtgataaaccagaa
gcacgcgctgttggacgggcaaattatcatcatattccgtgttttgctttttcagcgaaa
gcatatgagtcaaaagaagcatttgaaaaagagatattaaagaagctagaagaatatgaa
attgattatgttattttagctggatatatgcggttaatcgggccgacgttactagaagca
tacggtgggaagattattaatattcatccatcattactaccgagctttccgggtaaagat
gctgtcggtcaagcgttagaagcaggtgtgaaagtaactggagtaacaattcattatgta
gatgcaggtatggatacagggccaattattgcgcaagaagcagtggttgtttctgaaggg
gatacgagagaaagtttacaaaagaaaattcaacaagttgaacataaattatacgtaaat
acagtgaatcaaattgttcagtctgtgaaagaatcaactgttaactaa

DBGET integrated database retrieval system