KEGG   Bacillus thuringiensis BMB171: BMB171_C0324Help
Entry
BMB171_C0324      CDS       T01239                                 

Definition
L-fuculose phosphate aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
btb  Bacillus thuringiensis BMB171
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:btb00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
381321..381962
Genome map
AA seq 213 aa AA seqDB search
MLLQKEREEIVAYGKKMISSGLTKGTGGNISIFNREQGLVAISPSGLEYYETKPEDVVIL
NLDGEVVEGERKPSSELDMHLIYYRKREDINALVHTHSPYAKTIASLGWELPAVSYLIAF
AGPNVRCAPYETFGTKQLAEAAFEGMIDRRAVLLANHGLIAGANNIKMAFTVAEEIEFCA
QIYYQTKSIGEPKLLPEDEMENLAKKFEGYGQQ
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgttattacaaaaagaaagagaagaaattgtagcgtatggaaagaaaatgatttctagt
ggtttaacaaagggaacgggcggtaatattagtatctttaatcgtgaacaaggtcttgtt
gcgattagcccaagtggtttagagtattatgaaacaaagcctgaagatgtagttatatta
aacctagatggtgaagtagtagaaggagagagaaaaccatcaagtgaattagatatgcac
cttatttactataggaagcgtgaagatataaatgcgcttgtgcatacacactctccttac
gcgaagacgattgcatcattaggatgggagcttcctgctgtatcgtatttaattgctttc
gcaggaccgaatgtgcgctgtgcaccgtatgaaacatttggtacgaagcaattagcggag
gctgcttttgaaggcatgattgatcgccgtgctgttttacttgcaaatcacggtttaatt
gctggtgcaaataatataaaaatggcgtttactgttgcagaagagattgagttttgtgct
caaatttattatcaaacgaaaagcattggggaaccaaagctattgccagaagatgagatg
gagaatttggcgaagaagtttgaagggtatgggcagcagtag

DBGET integrated database retrieval system