KEGG   Bacillus thuringiensis BMB171: BMB171_C0324Help
Entry
BMB171_C0324      CDS       T01239                                 

Definition
(GenBank) L-fuculose phosphate aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
btb  Bacillus thuringiensis BMB171
Pathway
btb00051  Fructose and mannose metabolism
btb01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:btb00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BMB171_C0324
Enzymes [BR:btb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     BMB171_C0324
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: ADH05142
Position
381321..381962
Genome map
AA seq 213 aa AA seqDB search
MLLQKEREEIVAYGKKMISSGLTKGTGGNISIFNREQGLVAISPSGLEYYETKPEDVVIL
NLDGEVVEGERKPSSELDMHLIYYRKREDINALVHTHSPYAKTIASLGWELPAVSYLIAF
AGPNVRCAPYETFGTKQLAEAAFEGMIDRRAVLLANHGLIAGANNIKMAFTVAEEIEFCA
QIYYQTKSIGEPKLLPEDEMENLAKKFEGYGQQ
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgttattacaaaaagaaagagaagaaattgtagcgtatggaaagaaaatgatttctagt
ggtttaacaaagggaacgggcggtaatattagtatctttaatcgtgaacaaggtcttgtt
gcgattagcccaagtggtttagagtattatgaaacaaagcctgaagatgtagttatatta
aacctagatggtgaagtagtagaaggagagagaaaaccatcaagtgaattagatatgcac
cttatttactataggaagcgtgaagatataaatgcgcttgtgcatacacactctccttac
gcgaagacgattgcatcattaggatgggagcttcctgctgtatcgtatttaattgctttc
gcaggaccgaatgtgcgctgtgcaccgtatgaaacatttggtacgaagcaattagcggag
gctgcttttgaaggcatgattgatcgccgtgctgttttacttgcaaatcacggtttaatt
gctggtgcaaataatataaaaatggcgtttactgttgcagaagagattgagttttgtgct
caaatttattatcaaacgaaaagcattggggaaccaaagctattgccagaagatgagatg
gagaatttggcgaagaagtttgaagggtatgggcagcagtag

DBGET integrated database retrieval system