KEGG   Bacillus thuringiensis BMB171: BMB171_C0425Help
Entry
BMB171_C0425      CDS       T01239                                 

Gene name
glsA1
Definition
glutaminase
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
btb  Bacillus thuringiensis BMB171
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:btb00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BMB171_C0425 (glsA1)
   00330 Arginine and proline metabolism
    BMB171_C0425 (glsA1)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    BMB171_C0425 (glsA1)
Enzymes [BR:btb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     BMB171_C0425 (glsA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(489028..489957)
Genome map
AA seq 309 aa AA seqDB search
MQCIETNNLQQLLEQVKPYTKKGKLATYIPELGNANPDDLGIAIFHKETEYIHAGNSQTL
FTLQSISKVITLALALLDRGEEYVFSKVGMEPTGDPFNSIIKLETTSPSKPLNPMINAGA
LAITSMLAGKDNEEKMERILHFVREITDNPTINYSSKVADSELETAYLNRSLCYYMKQNG
IIDCDIEELMDLYTRQCAVEVNCIDLARIGLIFAMDGYDPYKKKQIIPKHITKICKTFMV
TCGMYNESGEFAIRVGIPAKSGVAGGIFGCVKGDMGIGIFGPALDANGNSIAGFKILELL
SAQEGWSIF
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgcagtgcattgaaacaaacaacttacaacagttgttagaacaagtaaaaccatataca
aaaaaaggaaaacttgctacttatatccccgaactaggaaatgcaaatccagacgattta
gggattgccattttccataaagaaacagaatatatccatgcaggcaactcacaaacacta
tttactcttcaaagtatttccaaagtaattacacttgcccttgcccttttagaccgtggt
gaagaatatgtattttctaaagttggaatggaaccaacgggtgacccatttaattctatt
attaagttagaaacgacaagtccgtccaaaccccttaatccaatgataaatgcaggagca
ttagctattacaagcatgttagcaggaaaagataacgaggaaaaaatggaacgtattctt
cattttgtacgtgaaataacagataatcctactattaattattcctctaaagttgccgat
tcagaactagagacagcttacctaaaccgttcactttgttattatatgaaacaaaacgga
attatcgattgtgatattgaagaacttatggatttatatactcgtcaatgcgcagttgaa
gtaaactgcatcgatttagcacgtatcggcttaatttttgcaatggatggatatgatcca
tataaaaagaaacaaattatccctaaacatattacaaaaatttgcaaaacatttatggtc
acatgtggtatgtataacgaatctggtgaatttgcaattcgtgttggtattcctgcaaaa
agcggtgtagccggtggtatttttggctgcgtaaaaggagacatgggaatcggtattttc
ggaccagctttagatgcaaacggaaatagtattgctggttttaaaattcttgaacttctt
tctgctcaagaaggttggagcattttttaa

DBGET integrated database retrieval system