KEGG   Bacillus thuringiensis BMB171: BMB171_C0579Help
Entry
BMB171_C0579      CDS       T01239                                 

Gene name
rbsK
Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
btb  Bacillus thuringiensis BMB171
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:btb00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BMB171_C0579 (rbsK)
Enzymes [BR:btb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     BMB171_C0579 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
672835..673731
Genome map
AA seq 298 aa AA seqDB search
MPNIAVVGSISMDLVAVSKKRPKAGETVIGEAFHTIPGGKGANQAVAAARLGANVAMVGA
VGNDDYGTVVRKNLENERIFIDYVVPVTDRTTGIAHIVLAEEDNSIVVVQGANALVNKSV
VDRSKDLLVKADMVVLQLEIPLETVKYVLAICEEHNIPVMLNPAPAQVLSEEILEKATYI
TPNEHECRIVLDDFTSPIEDLLAKYPNKLLMTEGSNGVRFHNGTEIVHVPSIAVDVVDTT
GAGDTFNGALAVALSEGETLQKAIRFANIAGGLSVTKLGAQGGMPTRDRVREVQVIVG
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgccaaatattgcagtagtaggaagcatttcaatggacttagtggctgtttcaaaaaaa
cggccgaaagcaggagaaacagtaattggtgaagcgtttcatacaatcccaggagggaaa
ggggcaaaccaagcagttgctgcagctaggttaggagcaaatgtagcaatggttggagcg
gtaggaaatgatgattatggaacagtagttagaaaaaatttagagaacgaacgcattttt
atcgattatgtggtaccggttacagatagaacgacaggaattgctcatatcgttttagca
gaagaagataacagtattgttgtcgtacaaggggcaaatgctcttgtaaataagtcagtt
gtagatcgctccaaagaccttcttgtaaaagcggatatggttgttcttcaactagaaatt
ccacttgaaacagtaaaatatgtattggctatttgtgaggaacataatattcctgttatg
ttgaatccagcgccagcacaagttttatcagaagaaattttagaaaaagcaacttatatt
acgccaaatgaacatgagtgccgcatcgtattagatgattttacatcaccaattgaagat
ttattggcgaagtatccaaataaattattgatgacagaaggttctaacggtgttcgtttc
cataatggaacagagattgtacatgttcctagcattgctgttgatgtagtggatacaact
ggagctggtgatacatttaatggtgcgttagcagttgcactttctgaaggagagacactt
caaaaagcaattcgtttcgcgaatattgccggtggtctttctgtaacgaaacttggggca
cagggcggtatgccaacgagagatcgagtacgtgaagtgcaggtgattgttggatga

DBGET integrated database retrieval system