KEGG   Bacillus thuringiensis BMB171: BMB171_C0944Help
Entry
BMB171_C0944      CDS       T01239                                 

Gene name
hemY1
Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
btb  Bacillus thuringiensis BMB171
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:btb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BMB171_C0944 (hemY1)
Enzymes [BR:btb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     BMB171_C0944 (hemY1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1066769..1068190
Genome map
AA seq 473 aa AA seqDB search
MRKKVVIIGGGITGLTAMYNLQKNIHEKNLPIDTLLIEASGKLGGKIQTVRKDGFTIERG
PDSFLARKESAARLVKELGLGDELVNNQAGQSFILVNNRLHKMPNGSMMGIPTQITPFLF
SGLFSPIGKLRAGFDLLMPRSKPVSDQSLGQFFRHRLGNEVVENLIEPLLSGIYAGDIDE
MSLMSTFPQMYQIEQKHRSISLGMRTLAPKEEKAEPKKGMFQTVKTGLESIVKSLEAKMH
EGTIIKGTRIEKVAKQGDGYTITLSNGKEIEADAIVVATSHKVLPSMFAQYKQFRFFRNI
PSTSVANVALAFQKSAIQRDINGTGFVVSRNSDYTITACTWTHKKWPHTTPEGKTLLRCY
VGRAGDEAVVEQTEEELVQLVLEDLRKTMDITEDPEFTIVSRWKEAMPQYTVGHNERMKK
LTTFMEKELPGIYLAGSSYAGAGLPDCMNQGEEAAKRVLSHLEKVIDAELIPQ
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
ttgaggaaaaaggttgtgatcatcggcggaggcatcactggattaacagcaatgtataac
ttacaaaaaaatattcatgaaaaaaacttgccgattgatacattacttatagaagcatcg
ggtaaacttggcggaaaaattcaaaccgttcgaaaagatggatttacaattgagcgcgga
ccagattctttcttagcacgaaaagaaagtgcagctagattagtgaaagaattaggtctt
ggcgatgaacttgtaaataatcaagccggtcaatcatttatccttgtaaacaatcggtta
cataaaatgccgaatggatcaatgatgggaattccaacgcaaattacgccgtttctattt
tccgggctgttctccccaattggtaaactaagagctggctttgatctattaatgccgagg
tcaaagccagtatctgaccaatcactcggacaatttttcagacatcgtcttggaaacgaa
gtggttgaaaacttaatagagccgttactatcgggtatttatgcaggggatattgatgaa
atgagcttaatgtcaacattcccgcaaatgtatcaaattgagcagaaacatcgcagtatt
tcactcggtatgcgtacgctcgctccgaaagaagagaaagctgaaccgaaaaagggaatg
ttccaaacagtgaaaacaggtttagaatctatcgtaaaatctctcgaagcaaagatgcat
gaaggtacgataataaagggaactcgcattgaaaaagttgcgaaacagggtgatggttat
acgattactcttagtaacggaaaagaaatagaagcggacgccatcgtagtggcaacttcg
cataaagtattgccgtccatgtttgctcagtacaagcagtttcgtttcttccgtaatatt
ccatccacatccgttgcgaatgtggcacttgctttccaaaagtctgcaatccagcgcgat
attaatggtacaggatttgtcgtatcacgaaatagcgattacaccattacagcatgtacg
tggacgcataaaaaatggccacatacaacgccagaaggaaaaacactccttcgctgttac
gttggacgtgctggtgatgaagcggttgtagaacaaactgaagaagaactcgttcagctc
gtactagaagatttaaggaagacgatggatattacagaggatccagagtttacaatcgta
agtcgctggaaagaagcgatgcctcaatatacagtgggccataacgagcgaatgaaaaag
ctcacaacatttatggagaaagagttgccaggtatatacttggcaggtagctcctatgct
ggtgctggacttccagactgtatgaatcaaggtgaggaagctgcaaagcgtgtattatct
catttggagaaagtaatagatgctgaattaatcccacaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system