KEGG   Bacillus thuringiensis BMB171: BMB171_C0993Help
Entry
BMB171_C0993      CDS       T01239                                 

Gene name
aceB
Definition
(GenBank) malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
btb  Bacillus thuringiensis BMB171
Pathway
btb00620  Pyruvate metabolism
btb00630  Glyoxylate and dicarboxylate metabolism
btb01100  Metabolic pathways
btb01110  Biosynthesis of secondary metabolites
btb01120  Microbial metabolism in diverse environments
btb01200  Carbon metabolism
Module
btb_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:btb00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BMB171_C0993 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    BMB171_C0993 (aceB)
Enzymes [BR:btb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     BMB171_C0993 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: ADH05809
Position
1116737..1117993
Genome map
AA seq 418 aa AA seqDB search
MADFEDSNAPTWENAVEGQINLRDAVKGTISHENDKGKEYRLNEKTAVLIVRPRGWHLEE
KHMQVDGKNMSGSLVDFGLYFFHNAKALLAKGSGPYFYLPKMESYLEARLWNDVFVFAQK
YIGIPNGTIKATVLLETIHASFEMDEILYELKDHSAGLNCGRWDYIFSFLKSFRNHNKFL
LPDRAQVTMTAPFMRSYSLKVIQTCHRRNAPAIGGMAAQIPIKNNPEANEAAFEKVRADK
EREALDGHDGTWVAHPGLVPVAMEVFNHIMKTPNQIFRKREEICVTENDLLEVPVGTITE
EGLRMNISVGIQYIASWLSGRGAAPIYNLMEDAATAEISRAQVWQWIRHEGGKLNDGRNI
TLELMEELKEEELAKIEREIGKEAFKKGRFQEATTLFTDLVRNDEFVPFLTLLGYEIL
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggcggattttgaagattcgaatgcaccaacttgggaaaacgcagttgaagggcaaatc
aatttacgagatgcagtaaagggaacgatttcacatgaaaatgataaagggaaagaatat
agattaaatgagaaaacagctgtactcattgtacgtccaagaggatggcatttagaggaa
aagcatatgcaagttgatgggaaaaatatgtcgggtagtttagtagatttcggcttgtat
tttttccataatgcgaaagctcttttagcaaaagggagcggcccatacttttacttaccg
aaaatggaaagttatttagaagcgagattatggaatgatgtattcgtatttgctcaaaaa
tatatcggcattccaaacggaacgattaaagcaactgtgttactagaaacgattcacgct
tcgtttgaaatggatgaaattttatatgagctaaaagatcattctgctggcttaaattgc
ggaagatgggattatatttttagctttttaaagagtttccgtaatcataataaattctta
ctaccagatagagcacaagtcacgatgacggcgccatttatgcgttcgtattctttgaaa
gtaattcaaacatgtcaccgccgtaatgcaccagcaattggaggaatggcggcacaaatt
ccgattaaaaataatccagaagcaaatgaagcagcttttgaaaaagtgcgtgctgataag
gaacgcgaagctttagacggtcatgacgggacttgggttgcccaccctggacttgtaccg
gttgcaatggaagtgtttaatcacattatgaaaacaccaaatcaaatttttagaaaacgt
gaagaaatatgtgtaacagaaaacgatttactagaggtaccggtgggaacgattacagaa
gagggccttcgcatgaatattagcgtaggtattcaatatattgcatcttggttaagcgga
cggggagcagcacccatttataacttaatggaagatgcggcaacagctgaaatttcaaga
gcacaagtatggcaatggattcgtcatgaaggtggaaaactaaatgatggtcgtaatatt
acgcttgaattaatggaagagctaaaagaagaagaattagcaaaaatagaaagagagatt
ggtaaggaagcctttaagaaagggagattccaagaggcgacaacgttgtttacagatctc
gttcgaaatgatgaattcgtaccatttttaacattactgggttatgaaattttataa

DBGET integrated database retrieval system