KEGG   Bacillus thuringiensis BMB171: BMB171_C0993Help
Entry
BMB171_C0993      CDS       T01239                                 

Gene name
aceB
Definition
malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
btb  Bacillus thuringiensis BMB171
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:btb01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:btb00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:btb00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1116737..1117993
Genome map
AA seq 418 aa AA seqDB search
MADFEDSNAPTWENAVEGQINLRDAVKGTISHENDKGKEYRLNEKTAVLIVRPRGWHLEE
KHMQVDGKNMSGSLVDFGLYFFHNAKALLAKGSGPYFYLPKMESYLEARLWNDVFVFAQK
YIGIPNGTIKATVLLETIHASFEMDEILYELKDHSAGLNCGRWDYIFSFLKSFRNHNKFL
LPDRAQVTMTAPFMRSYSLKVIQTCHRRNAPAIGGMAAQIPIKNNPEANEAAFEKVRADK
EREALDGHDGTWVAHPGLVPVAMEVFNHIMKTPNQIFRKREEICVTENDLLEVPVGTITE
EGLRMNISVGIQYIASWLSGRGAAPIYNLMEDAATAEISRAQVWQWIRHEGGKLNDGRNI
TLELMEELKEEELAKIEREIGKEAFKKGRFQEATTLFTDLVRNDEFVPFLTLLGYEIL
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggcggattttgaagattcgaatgcaccaacttgggaaaacgcagttgaagggcaaatc
aatttacgagatgcagtaaagggaacgatttcacatgaaaatgataaagggaaagaatat
agattaaatgagaaaacagctgtactcattgtacgtccaagaggatggcatttagaggaa
aagcatatgcaagttgatgggaaaaatatgtcgggtagtttagtagatttcggcttgtat
tttttccataatgcgaaagctcttttagcaaaagggagcggcccatacttttacttaccg
aaaatggaaagttatttagaagcgagattatggaatgatgtattcgtatttgctcaaaaa
tatatcggcattccaaacggaacgattaaagcaactgtgttactagaaacgattcacgct
tcgtttgaaatggatgaaattttatatgagctaaaagatcattctgctggcttaaattgc
ggaagatgggattatatttttagctttttaaagagtttccgtaatcataataaattctta
ctaccagatagagcacaagtcacgatgacggcgccatttatgcgttcgtattctttgaaa
gtaattcaaacatgtcaccgccgtaatgcaccagcaattggaggaatggcggcacaaatt
ccgattaaaaataatccagaagcaaatgaagcagcttttgaaaaagtgcgtgctgataag
gaacgcgaagctttagacggtcatgacgggacttgggttgcccaccctggacttgtaccg
gttgcaatggaagtgtttaatcacattatgaaaacaccaaatcaaatttttagaaaacgt
gaagaaatatgtgtaacagaaaacgatttactagaggtaccggtgggaacgattacagaa
gagggccttcgcatgaatattagcgtaggtattcaatatattgcatcttggttaagcgga
cggggagcagcacccatttataacttaatggaagatgcggcaacagctgaaatttcaaga
gcacaagtatggcaatggattcgtcatgaaggtggaaaactaaatgatggtcgtaatatt
acgcttgaattaatggaagagctaaaagaagaagaattagcaaaaatagaaagagagatt
ggtaaggaagcctttaagaaagggagattccaagaggcgacaacgttgtttacagatctc
gttcgaaatgatgaattcgtaccatttttaacattactgggttatgaaattttataa

DBGET integrated database retrieval system