KEGG   Bacillus thuringiensis BMB171: BMB171_C1014Help
Entry
BMB171_C1014      CDS       T01239                                 

Gene name
asnO1
Definition
asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
btb  Bacillus thuringiensis BMB171
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:btb00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BMB171_C1014 (asnO1)
Enzymes [BR:btb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     BMB171_C1014 (asnO1)
Peptidases [BR:btb01002]
 Cysteine Peptidases
  Family C44
   BMB171_C1014 (asnO1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1138963..1140819
Genome map
AA seq 618 aa AA seqDB search
MIYMCGITGWVDYKRSLEGERDVVTKMAETLAKRGPDDNKVWIKGNVAFGHKRLIVVDPE
GGKQPMTCLKDETNYAICYNGELYNTEDIRKELLRRGYTFKGHSDTEVLLASYIEWKEEC
VDHLNGIYAFAVWDEQKEQVFIARDRLGVKPLFYKYDSGRLLFGSELKAILSHPDVKAEV
TLEGLSEIFGLGPSRTPGHGIYAGIKELRPGHAMTFSKNGLCIWRYWNVESKKHEDSFEE
TVEKTRFLLQDAITRQLVSDVPLCTFLSGGVDSSAITAIAAKEYERSGKGQLHTYSIDYE
DNDKYFKANAFQPNSDAPFINLMTETFQTTHHRCVISNEKLAEYLTEAVLVRDLPGMADI
DSSLLWFCREIKQDFVVGLSGECADEIFGGYPWFYREDDLQSSAFPWMRSTEAREQLLKK
EWRNKLNLQQYVQRRYEESIQEVPILEGESPLEAKRRQLFYLNMVWFMTTLLDRKDRMSM
GASLEVRVPFADHRLVEYAWNIPWEMKMYKNREKGLLRKALEGVLPHDILYRKKSPYPKT
HNPHYTKAITVWLQNLLTDKGSILHELFDKEQLSGLIQSGGSAFQTPWFGQLMTGPQLLA
HLAQIHVWFKEYGVNIKE
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
atgatttatatgtgcgggattacaggatgggtggattataaacgctcattagaaggagaa
agagatgtcgttacgaagatggctgagacgttagcgaaacgggggccggatgataataaa
gtttggattaaaggaaatgtcgcatttgggcataagcggttaatcgttgtggatcctgag
ggcggtaaacagccgatgacttgtttaaaagatgaaacgaattacgccatttgctataac
ggtgaactttataacacagaagacattcgaaaggaattattaagaagaggatatacgttc
aaaggtcattctgatacagaagtattattagcttcttatattgaatggaaagaagaatgt
gtcgatcatttaaacggtatatatgcgtttgcagtatgggacgaacagaaagaacaagta
tttattgcgagagatcgattaggtgtaaagccacttttttataaatatgatagcggacgc
ttactatttggttcggagttaaaagcgatattgtcgcatccagatgtgaaggcggaagta
acgttagaaggattatcagaaatattcgggctcggaccgtcaagaacgcctggccacggt
atttatgctggtataaaagaattgcgtccaggtcatgcgatgacattttcaaagaacggt
ttgtgtatatggagatattggaatgtagaaagtaaaaaacatgaagactcttttgaagaa
acagtagagaaaacgcgctttttattacaagatgctattacaagacagcttgtttctgat
gtaccactatgtacttttttatcgggtggtgtagattcgagcgctattacagctattgca
gcgaaagaatatgagagatcgggaaaagggcaattacacacgtattctattgattacgaa
gataatgacaaatactttaaagcgaatgcattccagccaaattcagatgctccgtttatt
aatttaatgactgagacatttcaaacaacccatcatcgctgcgtcatttcgaatgaaaaa
ttagcagagtatttaactgaagcagtactcgttcgtgatttgcctggtatggcagatatc
gattcgtcattattatggttttgccgagaaattaaacaagattttgttgttggcttatct
ggagaatgtgcagatgaaatatttggtggatatccgtggttttatagagaagatgattta
caatcgagtgcatttccgtggatgcgttctacagaggcacgtgaacaacttctaaaaaaa
gaatggagaaataaattaaatttacaacaatatgtacaaaggcgctatgaagagtcgatt
caagaagttcctattttagagggggaaagtccgctagaagcaaaaagacgccaattattt
tatttaaatatggtatggtttatgacaacattattagacagaaaagaccgcatgagtatg
ggagcgagcttagaagtacgtgttccatttgcagatcatcgtcttgtcgaatatgcgtgg
aatattccttgggaaatgaaaatgtataaaaaccgcgaaaaaggtctattacgtaaagcg
ttagaaggtgtacttccacatgacatcttatatagaaagaagagtccttatccgaaaaca
cacaatccacactatacaaaagcaataacagtatggcttcaaaatctattaacggataaa
ggttcaattttacacgaactgtttgataaagagcagttgagcggattaattcagtctggc
ggcagtgcatttcaaacaccatggtttggtcaattgatgactgggccacagcttttagct
catttagcacaaattcacgtttggtttaaagaatatggggtaaatattaaagaatag

DBGET integrated database retrieval system