KEGG   Bacillus thuringiensis BMB171: BMB171_C1097Help
Entry
BMB171_C1097      CDS       T01239                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
btb  Bacillus thuringiensis BMB171
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:btb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BMB171_C1097 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BMB171_C1097 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BMB171_C1097 (trpB)
Enzymes [BR:btb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BMB171_C1097 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1227663..1228856
Genome map
AA seq 397 aa AA seqDB search
MNYAYPDEKGHYGIYGGRYVPETLMQSVLELEEAYKEAMQDEAFQKELNHYLKTYVGRET
PLYYAENMTKYCGGAKIYLKREDLNHTGAHKINNTIGQALLAVRMGKKKVVAETGAGQHG
VATATVCALLGLECVIFMGEEDVRRQKLNVFRMELLGAKVESVAAGSGTLKDAVNEALRY
WVSHVHDTHYIMGSVLGPHPFPQIVRDFQSVIGNETKKQYEALEGKLPEAVVACIGGGSN
AMGMFYPFVHDEEVALYGVEAAGKGVHTEKHAATLTKGSVGVLHGSMMYLLQNEEGQIQE
AHSISAGLDYPGVGPEHSLLKDIGRVSYHSITDEEALEAFQLLTKKEGIIPALESSHAVA
YALKLAPKMKEDEGLVICLSGRGDKDVESIKRYMEEV
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaactacgcatatccagatgaaaaaggacattacggtatatacggaggacgatacgtt
ccagaaacgttaatgcaatctgtactagaactagaagaagcatataaagaagcgatgcaa
gatgaagcatttcaaaaggaattaaatcattatttaaaaacgtacgtcggaagagaaaca
ccgctatattatgctgaaaatatgacgaagtattgcggtggtgcaaagatttatttaaaa
cgtgaagatttgaatcatacaggagctcataaaattaacaatacaatcggtcaggcacta
cttgcagtgcgaatgggcaagaaaaaagttgtcgctgaaacaggagctggacaacacgga
gttgcaacagctactgtatgtgctcttctcggattagaatgcgtcatttttatgggagaa
gaagatgtaagacgtcaaaaattaaatgtgttccgaatggaattactcggagcgaaagta
gaaagtgtagcggcaggtagcggtacattaaaagatgcggtaaacgaggcgcttcgttac
tgggtttcacatgtgcatgatacgcactacattatgggatctgttctcggaccacatcca
ttcccgcaaattgtccgtgatttccaaagtgtaattggaaatgaaacgaaaaaacaatat
gaggcgttagaaggaaagttaccagaagcagtcgttgcttgtattggcggtggtagtaat
gcgatggggatgttttatccgttcgtacacgatgaagaagttgctctttacggcgtagaa
gcagctggaaaaggcgttcatacagaaaagcatgcagcaactttaacgaaaggaagcgtt
ggcgttctccacggatcaatgatgtatcttctgcaaaacgaagaaggacaaattcaagaa
gcacactctatttcagcaggacttgattatccaggtgttggtccagaacatagcttgcta
aaagatattggccgcgtttcttatcattcgataacagacgaagaagcattagaagcattt
caattattaacgaaaaaagaaggtattatcccggcgttagaaagctcgcatgctgtcgca
tacgcattaaaattagctccgaaaatgaaggaagatgaaggacttgttatttgtttatct
ggccgtggtgataaagatgtagagagtataaaacgttatatggaagaggtgtaa

DBGET integrated database retrieval system