KEGG   Bacillus thuringiensis BMB171: BMB171_C1098Help
Entry
BMB171_C1098      CDS       T01239                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
btb  Bacillus thuringiensis BMB171
Pathway
btb00260  Glycine, serine and threonine metabolism
btb00400  Phenylalanine, tyrosine and tryptophan biosynthesis
btb01100  Metabolic pathways
btb01110  Biosynthesis of secondary metabolites
btb01130  Biosynthesis of antibiotics
btb01230  Biosynthesis of amino acids
Module
btb_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:btb00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BMB171_C1098 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BMB171_C1098 (trpA)
Enzymes [BR:btb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BMB171_C1098 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth BtpA PcrB NMO
Motif
Other DBs
NCBI-ProteinID: ADH05914
Position
1228860..1229636
Genome map
AA seq 258 aa AA seqDB search
MGVEKIKAAFENGKKAFIPYVMGGDGGLEKLKERIRFLDEAGASIVEIGIPFSDPVADGP
TIQRAGKRALDSGVTLKGIFQALAEVRKEVQMPFVLMTYLNPVLAFGKERFIENCIEAGV
DGIIVPDLPYEEQNIIAPLLREVNIALIPLVTVTSPIERIEKITSESEGFVYAVTVAGVT
GVRQNFKEEIHSYLEKVKSHVNLPVVAGFGISTKEHVEEMVTICDGVVVGSKVIELLENE
KREEICELIYATKQKEEA
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgggagtagaaaaaattaaagcagcgtttgaaaatggcaagaaagcatttattccgtac
gtaatgggcggagatggtggccttgaaaaattaaaagaaagaattcgttttctagatgag
gctggagcaagcatcgttgaaattggtattccgttttcagatccagtcgcagatggccca
acgattcaaagagcagggaaacgagcgctagatagcggcgtaacattaaaaggcattttt
caagcgttagcagaggtaaggaaagaagtacaaatgccttttgttcttatgacatattta
aatccggtacttgcattcggaaaagagagattcattgagaactgtatagaagcaggtgta
gacggcatcatcgttccagacttaccgtatgaagaacaaaatattattgcgccgttactt
cgagaggtaaacattgcgctcatcccactggttaccgtaacgagtcctattgaaagaatt
gaaaaaattacgagtgaatcagaagggttcgtttatgctgttacagtagcgggcgtaacg
ggagtacgtcaaaactttaaagaggagattcatagttacttagaaaaagtaaaatcacac
gtcaacttaccagtagtcgctggattcggcatctcaacaaaagaacatgtagaagaaatg
gttacaatatgcgacggagttgtcgttggaagtaaggtcattgagcttttagaaaatgaa
aagcgagaagaaatatgtgaattaatatatgcaacaaaacaaaaagaagaggcatag

DBGET integrated database retrieval system