KEGG   Bacillus thuringiensis BMB171: BMB171_C1098Help
Entry
BMB171_C1098      CDS       T01239                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
btb  Bacillus thuringiensis BMB171
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:btb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BMB171_C1098 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BMB171_C1098 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BMB171_C1098 (trpA)
Enzymes [BR:btb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BMB171_C1098 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1228860..1229636
Genome map
AA seq 258 aa AA seqDB search
MGVEKIKAAFENGKKAFIPYVMGGDGGLEKLKERIRFLDEAGASIVEIGIPFSDPVADGP
TIQRAGKRALDSGVTLKGIFQALAEVRKEVQMPFVLMTYLNPVLAFGKERFIENCIEAGV
DGIIVPDLPYEEQNIIAPLLREVNIALIPLVTVTSPIERIEKITSESEGFVYAVTVAGVT
GVRQNFKEEIHSYLEKVKSHVNLPVVAGFGISTKEHVEEMVTICDGVVVGSKVIELLENE
KREEICELIYATKQKEEA
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgggagtagaaaaaattaaagcagcgtttgaaaatggcaagaaagcatttattccgtac
gtaatgggcggagatggtggccttgaaaaattaaaagaaagaattcgttttctagatgag
gctggagcaagcatcgttgaaattggtattccgttttcagatccagtcgcagatggccca
acgattcaaagagcagggaaacgagcgctagatagcggcgtaacattaaaaggcattttt
caagcgttagcagaggtaaggaaagaagtacaaatgccttttgttcttatgacatattta
aatccggtacttgcattcggaaaagagagattcattgagaactgtatagaagcaggtgta
gacggcatcatcgttccagacttaccgtatgaagaacaaaatattattgcgccgttactt
cgagaggtaaacattgcgctcatcccactggttaccgtaacgagtcctattgaaagaatt
gaaaaaattacgagtgaatcagaagggttcgtttatgctgttacagtagcgggcgtaacg
ggagtacgtcaaaactttaaagaggagattcatagttacttagaaaaagtaaaatcacac
gtcaacttaccagtagtcgctggattcggcatctcaacaaaagaacatgtagaagaaatg
gttacaatatgcgacggagttgtcgttggaagtaaggtcattgagcttttagaaaatgaa
aagcgagaagaaatatgtgaattaatatatgcaacaaaacaaaaagaagaggcatag

DBGET integrated database retrieval system