KEGG   Bacillus thuringiensis BMB171: BMB171_C1109Help
Entry
BMB171_C1109      CDS       T01239                                 

Gene name
odhB
Definition
dihydrolipoamide acetyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
btb  Bacillus thuringiensis BMB171
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:btb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BMB171_C1109 (odhB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BMB171_C1109 (odhB)
  Amino acid metabolism
   00310 Lysine degradation
    BMB171_C1109 (odhB)
Enzymes [BR:btb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BMB171_C1109 (odhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1243700..1244959)
Genome map
AA seq 419 aa AA seqDB search
MIEIKVPELAESITEGTISQWLINVGDKVEKGGSVVELETDKVNVEIIAEDSGIVSKLLG
EPGDTVEVGATIAILDANGAPVAVSTPAPAAEQPKQETAEAPKAAAPSAEQTTTLQGLPN
TNRPIASPAARKMARELGIDLNDVRSTDPLGRVRPHDVQAHAAAPKEAPAAPKSPAPAPV
AKTEFEKPVERVKMSRRRQTIAKRLVEVQQTSAMLTTFNEVDMSAIMELRKERKDAFEKK
HDVRLGFMSFFTKAVVAALKQFPLLNAEIQGDELIIKKFYDIGIAVAAPDGLVVPVVRDA
NQLNFAEIESEIRELGKKARDNKLSLKELQGGTFTITNGGVFGSLMSTPILNSPQVGILG
MHKIQVRPVAIDNERMENRPMMYIALSYDHRIVDGKEAVSFLVAVKDMLEDPKSLLLEG
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaaattaaagtacctgagcttgcagaatctattactgaaggaactatttcacaa
tggcttatcaacgtaggcgacaaagttgagaaaggtggcagcgttgttgagcttgaaact
gataaagtcaatgtagaaatcattgcagaagattcaggtattgtatcgaagttactaggc
gaacctggggatacagttgaagttggcgcaactatcgcaattttagatgctaatggagca
ccagttgcagtaagtacacctgcaccggctgctgagcaaccaaaacaagaaacagctgaa
gcaccgaaagctgcggcaccaagtgctgagcaaactacaacactacaagggttaccaaat
acaaaccgtcctatcgcatcaccagctgctagaaagatggctcgtgaattaggaatcgac
ttaaacgacgtacgtagtacagatccacttggacgcgtgagaccacatgatgtacaagct
catgctgcagcaccaaaagaagcaccagctgctccaaagagtccagctcctgctccagtt
gcaaaaacggaattcgaaaaaccagttgagcgcgtgaaaatgtcccgccgccgtcaaaca
attgcaaaacgtcttgtagaagttcaacaaacatctgcaatgttaacaacatttaacgaa
gttgatatgagtgcgatcatggaattacgtaaagaacgcaaagatgctttcgagaaaaaa
catgatgtacgtcttggcttcatgtcattcttcacaaaagcagttgttgcagcattaaaa
caattcccattattaaatgctgaaattcaaggtgacgagcttatcattaaaaaattctat
gatatcggtattgcagtagcagctccagatggattagttgttccagttgtacgcgatgct
aaccaattaaacttcgctgaaatcgaaagcgaaattcgtgaattaggtaaaaaagcacgc
gataacaaactttcattaaaagaactacaaggtggtacatttacaattacaaacggtggt
gtattcggttctctaatgtcaacaccgatcctaaatagccctcaagttggtattttagga
atgcataaaatccaagtacgcccagttgcaattgataacgagcgtatggaaaaccgccca
atgatgtacattgctttatcttacgatcaccgtattgttgatggtaaagaagcagttagc
ttccttgttgctgttaaagatatgcttgaagatccaaagtcattattattagaaggttga

DBGET integrated database retrieval system