KEGG   Bacillus thuringiensis BMB171: BMB171_C1109Help
Entry
BMB171_C1109      CDS       T01239                                 

Gene name
odhB
Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
btb  Bacillus thuringiensis BMB171
Pathway
btb00020  Citrate cycle (TCA cycle)
btb00310  Lysine degradation
btb01100  Metabolic pathways
btb01110  Biosynthesis of secondary metabolites
btb01120  Microbial metabolism in diverse environments
btb01130  Biosynthesis of antibiotics
btb01200  Carbon metabolism
Module
btb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
btb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:btb00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BMB171_C1109 (odhB)
  Amino acid metabolism
   00310 Lysine degradation
    BMB171_C1109 (odhB)
Enzymes [BR:btb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BMB171_C1109 (odhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N
Motif
Other DBs
NCBI-ProteinID: ADH05925
Position
complement(1243700..1244959)
Genome map
AA seq 419 aa AA seqDB search
MIEIKVPELAESITEGTISQWLINVGDKVEKGGSVVELETDKVNVEIIAEDSGIVSKLLG
EPGDTVEVGATIAILDANGAPVAVSTPAPAAEQPKQETAEAPKAAAPSAEQTTTLQGLPN
TNRPIASPAARKMARELGIDLNDVRSTDPLGRVRPHDVQAHAAAPKEAPAAPKSPAPAPV
AKTEFEKPVERVKMSRRRQTIAKRLVEVQQTSAMLTTFNEVDMSAIMELRKERKDAFEKK
HDVRLGFMSFFTKAVVAALKQFPLLNAEIQGDELIIKKFYDIGIAVAAPDGLVVPVVRDA
NQLNFAEIESEIRELGKKARDNKLSLKELQGGTFTITNGGVFGSLMSTPILNSPQVGILG
MHKIQVRPVAIDNERMENRPMMYIALSYDHRIVDGKEAVSFLVAVKDMLEDPKSLLLEG
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaaattaaagtacctgagcttgcagaatctattactgaaggaactatttcacaa
tggcttatcaacgtaggcgacaaagttgagaaaggtggcagcgttgttgagcttgaaact
gataaagtcaatgtagaaatcattgcagaagattcaggtattgtatcgaagttactaggc
gaacctggggatacagttgaagttggcgcaactatcgcaattttagatgctaatggagca
ccagttgcagtaagtacacctgcaccggctgctgagcaaccaaaacaagaaacagctgaa
gcaccgaaagctgcggcaccaagtgctgagcaaactacaacactacaagggttaccaaat
acaaaccgtcctatcgcatcaccagctgctagaaagatggctcgtgaattaggaatcgac
ttaaacgacgtacgtagtacagatccacttggacgcgtgagaccacatgatgtacaagct
catgctgcagcaccaaaagaagcaccagctgctccaaagagtccagctcctgctccagtt
gcaaaaacggaattcgaaaaaccagttgagcgcgtgaaaatgtcccgccgccgtcaaaca
attgcaaaacgtcttgtagaagttcaacaaacatctgcaatgttaacaacatttaacgaa
gttgatatgagtgcgatcatggaattacgtaaagaacgcaaagatgctttcgagaaaaaa
catgatgtacgtcttggcttcatgtcattcttcacaaaagcagttgttgcagcattaaaa
caattcccattattaaatgctgaaattcaaggtgacgagcttatcattaaaaaattctat
gatatcggtattgcagtagcagctccagatggattagttgttccagttgtacgcgatgct
aaccaattaaacttcgctgaaatcgaaagcgaaattcgtgaattaggtaaaaaagcacgc
gataacaaactttcattaaaagaactacaaggtggtacatttacaattacaaacggtggt
gtattcggttctctaatgtcaacaccgatcctaaatagccctcaagttggtattttagga
atgcataaaatccaagtacgcccagttgcaattgataacgagcgtatggaaaaccgccca
atgatgtacattgctttatcttacgatcaccgtattgttgatggtaaagaagcagttagc
ttccttgttgctgttaaagatatgcttgaagatccaaagtcattattattagaaggttga

DBGET integrated database retrieval system