KEGG   Bacillus thuringiensis BMB171: BMB171_C1244Help
Entry
BMB171_C1244      CDS       T01239                                 

Gene name
hisD
Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
btb  Bacillus thuringiensis BMB171
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:btb01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:btb00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1373323..1374612
Genome map
AA seq 429 aa AA seqDB search
MEIIYEEFKEALSKIKVLRENANIIEETVQRSVREIIRHVREGKDEALSFYTKKFDGVEM
KNFRVSEEEIQQASMFVENSFLEALKEAKKNVVSYHEKQKKHSIFDCESKGIIRGQLIRP
LENVGVYVPGGTASYPSSVLMNVLPAKLAGVKKIVMVTPPRKGGIDPHILAAADLAGVDE
IYTIGGAQAIAALAYGTESIPKVDKIVGPGNLYVALAKREVYGIVNIDMIAGPSEIVVVA
DETGNAKYIAADLLSQAEHDERATAICITTNMELAKEVEKEVERQLETLPRSEIARESIN
RNGAIFIVPSLEEALKLSNEIAPEHLELHIKEPMNALDYVKHAGSIFLGPYSPEPLGDYL
AGPNHVLPTSGTARFFSPLSVDDFVKKSSFISYTEEALKNVQHHIVELANKEGLHAHARA
IQIRFEEEK
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atggaaatcatttatgaagaatttaaggaggcattatctaaaataaaagtgctaagagaa
aacgctaatataatagaagaaactgttcaaagaagtgtaagagaaatcattagacatgta
agggaagggaaagatgaagctttatctttctatacaaaaaagtttgatggtgtagagatg
aaaaattttcgtgtaagtgaagaagaaatacagcaagcgagtatgtttgtagagaattca
tttttagaagctttaaaagaggcgaagaaaaacgttgtttcgtatcacgaaaagcaaaag
aagcactcaatattcgattgtgaaagtaaagggataattagagggcaactcattcggccg
ttagaaaatgtaggtgtatatgtaccgggtgggacagcctcatatccttcttcagtatta
atgaatgtattgccggcgaaactcgcaggtgtgaaaaagattgtaatggtaacaccgccg
aggaaaggaggaattgatccacatatattagctgctgcagatcttgcgggagtagatgaa
atttatacgataggtggcgcacaagcaattgctgctttagcatacgggacggaatcgatt
ccgaaagtggataaaatagttggaccgggaaatttgtacgtcgctctagcgaaacgagaa
gtatacggaatagtaaatatcgatatgattgctggtccatcagaaattgtagttgtcgcg
gatgaaacaggtaatgcaaaatatatcgcagcggatttattatcgcaagcagagcatgat
gagagagcaacggcgatttgtattacaacgaatatggaactagctaaagaagtagaaaaa
gaggtagaaagacagttagaaacgttaccaagaagtgaaattgcacgtgaatcaataaat
agaaatggagccatctttatcgttccttctttagaggaggcgctaaagttatcaaatgaa
attgctccagaacatttagagttacatataaaagaaccaatgaatgctctagattatgtg
aaacatgcaggctctattttccttgggccatattcacctgaaccgctcggggattattta
gcgggaccgaatcatgtattaccaacgagcggaacggcaagatttttttctccgttatca
gtcgatgatttcgtgaaaaaatcaagttttatttcttatacggaggaagcattaaaaaat
gtacagcatcatattgtagagcttgcaaataaagaagggttacatgcacatgcgagagca
atccaaataaggtttgaggaggaaaagtaa

DBGET integrated database retrieval system