KEGG   Bacillus thuringiensis BMB171: BMB171_C1344Help
Entry
BMB171_C1344      CDS       T01239                                 

Gene name
folE
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
btb  Bacillus thuringiensis BMB171
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:btb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BMB171_C1344 (folE)
Enzymes [BR:btb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     BMB171_C1344 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1469114..1469683
Genome map
AA seq 189 aa AA seqDB search
MAKVNLEQIEHAVRLILEAIGDDPNREGVLDTPKRVAKMYAEVFSGMHEDPKEHLHKVFG
EDHEELVLVKDIPFYSMCEHHLVPFYGVAHVAYIPQGGKVTGLSKLARTVDTIARRPQLQ
ERITSTVANSIMEVLEPHGVMVVVEAEHMCMTMRGVKKPGAKTVTTAVRGVLENDAAARS
EILSFIKTK
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagttaatttagaacaaattgaacatgcagtacgccttattttagaggcgatt
ggggatgacccaaatcgtgagggagtacttgatacaccaaagcgtgttgcaaaaatgtac
gcagaagtgttctcaggtatgcatgaagatccgaaagagcatttgcataaagtattcgga
gaagatcacgaagagcttgtactagtaaaagatataccattttattcgatgtgtgagcat
catttggtaccattctatggagttgctcacgttgcatatattccgcaaggtggaaaggta
acagggttaagtaaattagctcgtaccgtagatacaattgcacgtcgcccacaactgcaa
gaacgtattacatcaacagtagcgaactctattatggaagtactagagcctcatggtgta
atggtagtagtagaagcagaacatatgtgtatgacgatgcgtggtgtgaaaaaaccaggt
gcgaaaacagtaacgacagcagtgcgtggtgtgcttgaaaatgatgctgcagcgcgcagt
gaaattttatcgtttattaaaacgaagtaa

DBGET integrated database retrieval system