KEGG   Bacillus thuringiensis BMB171: BMB171_C1753Help
Entry
BMB171_C1753      CDS       T01239                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
btb  Bacillus thuringiensis BMB171
Pathway
btb00260  Glycine, serine and threonine metabolism
btb00750  Vitamin B6 metabolism
btb01100  Metabolic pathways
btb01110  Biosynthesis of secondary metabolites
btb01120  Microbial metabolism in diverse environments
btb01230  Biosynthesis of amino acids
Module
btb_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:btb00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BMB171_C1753 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BMB171_C1753 (thrC)
Enzymes [BR:btb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BMB171_C1753 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP PK_C
Motif
Other DBs
NCBI-ProteinID: ADH06568
Position
1874417..1875475
Genome map
AA seq 352 aa AA seqDB search
MYKGLLKQYASYLPVNENTPDVSLMEGNTPLIPLLNISKQLGIQLYGKYEGANPTGSFKD
RGMVMAVAKAKEEGSEAIICASTGNTSASAAAYAARLGMKCIIVIPEGKIAHGKLAQAVA
YGAEIISIEGNFDDALKAVRNIAAEEPITLVNSVNPYRIEGQKTAAFEICDQLQNAPDVL
AIPVGNAGNITAYWKGFCEYEKEKGYKKPRIHGFEAEGAAAIVKGHVIEEPETIATAIRI
GNPASWSYAVEAAEQSRGEIDMVSDEEILHAYRLLAKTEGVFAEPGSNASLAGVIKHVES
GKIKKGETVVAVLTGNGLKDPDIAISSNQLDIASVSNDIEQIKDHIKGVIMS
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgtataaaggactattaaaacagtatgcttcttatttaccggtgaatgaaaatacacct
gatgtcagcttaatggaaggaaacacaccacttattccattattaaacatatcaaaacaa
ttagggattcagctatacggtaagtacgaaggagcgaatccgacaggttcttttaaagat
cgtggtatggtcatggcagttgctaaggcgaaagaagaaggttcagaagcaatcatttgt
gcatcaacaggtaatacatcagcatcagctgcagcatatgcggcacgtcttgggatgaaa
tgtattatcgtaataccagaaggaaagattgcacatggaaaattagcgcaagcggtcgct
tatggagctgaaattatttcaatagaagggaatttcgatgatgcacttaaggctgtaaga
aatattgctgcagaagagccgattacgttagtaaattcagtgaatccttatcgaattgaa
gggcaaaaaacggcagcatttgaaatttgtgaccaattgcaaaatgcaccagatgttcta
gctatccctgttgggaacgcaggaaatattacagcatattggaaaggtttctgtgaatat
gagaaagaaaaaggttataagaagccaagaatccatggttttgaagcggaaggagcagct
gcaattgtaaaagggcatgtaattgaagaacctgaaacaattgcaacagcgattcgcatc
ggtaacccagcaagttggtcgtatgcagtagaggctgccgagcagtctcgtggtgaaata
gatatggtatcagatgaagaaattttacatgcgtataggttattagcaaaaactgaagga
gttttcgctgaaccaggatcaaatgcttcattagccggcgtaattaaacatgttgaatct
ggaaaaatcaaaaagggagaaacagttgttgcagtattaactggaaatggtttgaaggat
cctgatatcgctatttcttcaaatcaactagacatcgcaagtgtgtcaaatgatatagaa
caaattaaagatcatattaaaggggtgattatgtcgtga

DBGET integrated database retrieval system