KEGG   Bacillus thuringiensis BMB171: BMB171_C1753Help
Entry
BMB171_C1753      CDS       T01239                                 

Gene name
thrC
Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
btb  Bacillus thuringiensis BMB171
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:btb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BMB171_C1753 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BMB171_C1753 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BMB171_C1753 (thrC)
Enzymes [BR:btb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BMB171_C1753 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1874417..1875475
Genome map
AA seq 352 aa AA seqDB search
MYKGLLKQYASYLPVNENTPDVSLMEGNTPLIPLLNISKQLGIQLYGKYEGANPTGSFKD
RGMVMAVAKAKEEGSEAIICASTGNTSASAAAYAARLGMKCIIVIPEGKIAHGKLAQAVA
YGAEIISIEGNFDDALKAVRNIAAEEPITLVNSVNPYRIEGQKTAAFEICDQLQNAPDVL
AIPVGNAGNITAYWKGFCEYEKEKGYKKPRIHGFEAEGAAAIVKGHVIEEPETIATAIRI
GNPASWSYAVEAAEQSRGEIDMVSDEEILHAYRLLAKTEGVFAEPGSNASLAGVIKHVES
GKIKKGETVVAVLTGNGLKDPDIAISSNQLDIASVSNDIEQIKDHIKGVIMS
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgtataaaggactattaaaacagtatgcttcttatttaccggtgaatgaaaatacacct
gatgtcagcttaatggaaggaaacacaccacttattccattattaaacatatcaaaacaa
ttagggattcagctatacggtaagtacgaaggagcgaatccgacaggttcttttaaagat
cgtggtatggtcatggcagttgctaaggcgaaagaagaaggttcagaagcaatcatttgt
gcatcaacaggtaatacatcagcatcagctgcagcatatgcggcacgtcttgggatgaaa
tgtattatcgtaataccagaaggaaagattgcacatggaaaattagcgcaagcggtcgct
tatggagctgaaattatttcaatagaagggaatttcgatgatgcacttaaggctgtaaga
aatattgctgcagaagagccgattacgttagtaaattcagtgaatccttatcgaattgaa
gggcaaaaaacggcagcatttgaaatttgtgaccaattgcaaaatgcaccagatgttcta
gctatccctgttgggaacgcaggaaatattacagcatattggaaaggtttctgtgaatat
gagaaagaaaaaggttataagaagccaagaatccatggttttgaagcggaaggagcagct
gcaattgtaaaagggcatgtaattgaagaacctgaaacaattgcaacagcgattcgcatc
ggtaacccagcaagttggtcgtatgcagtagaggctgccgagcagtctcgtggtgaaata
gatatggtatcagatgaagaaattttacatgcgtataggttattagcaaaaactgaagga
gttttcgctgaaccaggatcaaatgcttcattagccggcgtaattaaacatgttgaatct
ggaaaaatcaaaaagggagaaacagttgttgcagtattaactggaaatggtttgaaggat
cctgatatcgctatttcttcaaatcaactagacatcgcaagtgtgtcaaatgatatagaa
caaattaaagatcatattaaaggggtgattatgtcgtga

DBGET integrated database retrieval system