KEGG   Bacillus thuringiensis BMB171: BMB171_C2116Help
Entry
BMB171_C2116      CDS       T01239                                 

Gene name
hemY2
Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
btb  Bacillus thuringiensis BMB171
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:btb00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2251817..2253208
Genome map
AA seq 463 aa AA seqDB search
MKTVVVIGGGITGLSTMFYLEKLKKDYNIDLNLILIEKEEYLGGKIHSVEEKDFIMESGA
DSIVARNEHVMPLVKDLNLENEMVYNETGISYIYSENMLHPIPSDTIFGIPMSAQSLFSS
TLVSTKGKIVALKDFITKNKEFTKDTSLALFLESFLGKELVERQIAPVLSGVYSGKLNEL
TMASTLPYLLDYKNKYGSIIKGFEENKKQFQSAGNKKFVSFKGGLSTIINRLEEVLTETV
VKKGAITTAVSKQKDRYEISFANHETIQADYVVLAAPHDIAQTLLQSNELNEQFNTFKNS
SLISIYLGFDILDEQLPADGTGFIVTENSDLHCDACTWTSRKWKHTSGKQKLLVRMFYKS
TNPVYETIKNYSEEELVRVALYDIEKSLGIKGEPEVVEVTNWKDLMPKYHLEHNQAVQAL
QEKMTNLYPNVYLAGASYYGVGIGACIGNGKNIANEIMDTLNK
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacagttgttgttatcggtggaggtataacgggactttctactatgttttattta
gaaaaattaaaaaaggattataatatcgatttaaatttaattcttattgagaaagaagag
tatttaggtggtaaaatccatagtgtggaagaaaaggatttcattatggagtcaggagcg
gattcaatcgttgctcgtaatgaacacgttatgccacttgtaaaagatttaaatttagaa
aatgaaatggtatataatgaaacgggtatttcttacatatattctgaaaacatgttacat
ccgattccttctgatactatatttgggataccgatgagcgcccagtcgttgtttagcagt
acgctagtctcaacgaaggggaaaatcgtagctttaaaagatttcataacgaaaaataaa
gagtttacgaaagatacatcacttgctttatttttagaaagctttttagggaaagagtta
gtggaaagacaaattgctcctgtgctttcaggtgtatattctggtaaattgaatgagctt
acaatggcatctacattaccgtatttactggattataaaaataagtatggaagtattatt
aaaggttttgaagagaataaaaaacaatttcaatcagcaggaaataaaaaattcgtatca
tttaaaggtggactatctacgataattaatcgcttagaagaagtgctgactgaaactgtc
gtaaaaaaaggtgctataacgacggctgtaagtaaacaaaaagatcgatatgagatttct
tttgcaaatcatgaaacaatacaagctgattatgttgttttagcagctccacatgatatt
gcacaaactttattacagtctaatgagttaaatgagcagtttaatacatttaaaaactca
tctcttataagtatttatttaggatttgacatactagatgaacaactaccagctgatggt
acggggtttattgtaacggaaaacagtgatttacattgtgatgcttgtacatggacaagt
cgaaagtggaaacatacatcgggtaaacaaaaattattagttagaatgttttataagagt
accaatccggtatatgaaacaatcaagaattacagtgaagaagaattagtacgagtcgct
ttatatgatattgaaaagagtctcggaattaaaggtgaaccagaagtagttgaagttaca
aattggaaagatttaatgccgaaatatcatttagaacataatcaagcggttcaagcatta
caagaaaaaatgacgaatctttatccaaatgtatatttagctggtgcctcatattatggt
gttggaattggtgcgtgtattggaaatggaaagaatatagccaatgaaataatggataca
ttaaataaataa

DBGET integrated database retrieval system