KEGG   Bacillus thuringiensis BMB171: BMB171_C2190Help
Entry
BMB171_C2190      CDS       T01239                                 

Gene name
gpm
Definition
(RefSeq) phosphoglyceromutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
btb  Bacillus thuringiensis BMB171
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:btb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BMB171_C2190 (gpm)
   01230 Biosynthesis of amino acids
    BMB171_C2190 (gpm)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMB171_C2190 (gpm)
  Energy metabolism
   00680 Methane metabolism
    BMB171_C2190 (gpm)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BMB171_C2190 (gpm)
Enzymes [BR:btb01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BMB171_C2190 (gpm)
Exosome [BR:btb04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BMB171_C2190 (gpm)
  Exosomal proteins of melanoma cells
   BMB171_C2190 (gpm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2329421..2330158
Genome map
AA seq 245 aa AA seqDB search
MIKLVLIRHGQSLWNLENRFTGWTDVDLSENGLSEAREAGAILKKNGYTFDVAYTSVLKR
AIRTLWIVLHEMDLTWVPIHKSWKLNERHYGALQGLNKDETAQKYGEEQVHIWRRSVDVR
PPALTEDDPRYEATDPRYKTLKKGEFPLTECLEDTEKRVLAYWHSEIAPTLKSGNKVIIS
SHGNTIRSLVKYLDNLSSDGVVSLNIPTSIPLVYELDENLRPIRHYYLSMDGEVPEGEIP
KHISF
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgataaaacttgtacttattcgtcacggacaaagcttatggaatcttgaaaatcgcttt
acgggatggacagatgttgatctatcagagaatggattaagtgaagcgagagaagcagga
gcaatattaaagaaaaacggatatacttttgatgtggcttatacatcagtattaaaacgc
gcaattcggacgttatggattgtacttcatgagatggatcttacttgggttccaatacat
aaatcttggaagctaaatgaaagacattatggtgcattgcaagggctgaataaagatgaa
actgcacaaaaatatggtgaggagcaagttcatatttggagaagaagtgttgatgtaaga
ccaccggctcttactgaagacgatcctcgatatgaagcgaccgatccaagatataaaaca
ctcaaaaaaggtgaatttccattaactgaatgtttagaggatacggagaagagagtactt
gcttattggcattcagaaattgcgccgacattaaaaagtggtaataaagtaattatttca
tcacacggtaacacaattcgctcgctagtaaaatatttagacaacctttcaagtgatggt
gtagtttcattaaatattcccactagcattccgcttgtttatgaattagacgaaaactta
cgtccgattcgtcattattatttaagtatggatggagaagtacctgaaggggaaattccg
aaacatatttctttttaa

DBGET integrated database retrieval system