KEGG   Bacillus thuringiensis BMB171: BMB171_C2190Help
Entry
BMB171_C2190      CDS       T01239                                 

Gene name
gpm
Definition
(GenBank) phosphoglyceromutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
btb  Bacillus thuringiensis BMB171
Pathway
btb00010  Glycolysis / Gluconeogenesis
btb00260  Glycine, serine and threonine metabolism
btb00680  Methane metabolism
btb01100  Metabolic pathways
btb01110  Biosynthesis of secondary metabolites
btb01120  Microbial metabolism in diverse environments
btb01130  Biosynthesis of antibiotics
btb01200  Carbon metabolism
btb01230  Biosynthesis of amino acids
Module
btb_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
btb_M00002  Glycolysis, core module involving three-carbon compounds
btb_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:btb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMB171_C2190 (gpm)
  Energy metabolism
   00680 Methane metabolism
    BMB171_C2190 (gpm)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BMB171_C2190 (gpm)
Enzymes [BR:btb01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BMB171_C2190 (gpm)
Membrane trafficking [BR:btb04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    BMB171_C2190 (gpm)
Exosome [BR:btb04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BMB171_C2190 (gpm)
  Exosomal proteins of melanoma cells
   BMB171_C2190 (gpm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ADH07002
Position
2329421..2330158
Genome map
AA seq 245 aa AA seqDB search
MIKLVLIRHGQSLWNLENRFTGWTDVDLSENGLSEAREAGAILKKNGYTFDVAYTSVLKR
AIRTLWIVLHEMDLTWVPIHKSWKLNERHYGALQGLNKDETAQKYGEEQVHIWRRSVDVR
PPALTEDDPRYEATDPRYKTLKKGEFPLTECLEDTEKRVLAYWHSEIAPTLKSGNKVIIS
SHGNTIRSLVKYLDNLSSDGVVSLNIPTSIPLVYELDENLRPIRHYYLSMDGEVPEGEIP
KHISF
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgataaaacttgtacttattcgtcacggacaaagcttatggaatcttgaaaatcgcttt
acgggatggacagatgttgatctatcagagaatggattaagtgaagcgagagaagcagga
gcaatattaaagaaaaacggatatacttttgatgtggcttatacatcagtattaaaacgc
gcaattcggacgttatggattgtacttcatgagatggatcttacttgggttccaatacat
aaatcttggaagctaaatgaaagacattatggtgcattgcaagggctgaataaagatgaa
actgcacaaaaatatggtgaggagcaagttcatatttggagaagaagtgttgatgtaaga
ccaccggctcttactgaagacgatcctcgatatgaagcgaccgatccaagatataaaaca
ctcaaaaaaggtgaatttccattaactgaatgtttagaggatacggagaagagagtactt
gcttattggcattcagaaattgcgccgacattaaaaagtggtaataaagtaattatttca
tcacacggtaacacaattcgctcgctagtaaaatatttagacaacctttcaagtgatggt
gtagtttcattaaatattcccactagcattccgcttgtttatgaattagacgaaaactta
cgtccgattcgtcattattatttaagtatggatggagaagtacctgaaggggaaattccg
aaacatatttctttttaa

DBGET integrated database retrieval system