KEGG   Bacillus thuringiensis BMB171: BMB171_C2248Help
Entry
BMB171_C2248      CDS       T01239                                 

Definition
(GenBank) Acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
btb  Bacillus thuringiensis BMB171
Pathway
btb00010  Glycolysis / Gluconeogenesis
btb00620  Pyruvate metabolism
btb00640  Propanoate metabolism
btb00680  Methane metabolism
btb01100  Metabolic pathways
btb01110  Biosynthesis of secondary metabolites
btb01120  Microbial metabolism in diverse environments
btb01130  Biosynthesis of antibiotics
btb01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:btb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMB171_C2248
   00620 Pyruvate metabolism
    BMB171_C2248
   00640 Propanoate metabolism
    BMB171_C2248
  Energy metabolism
   00680 Methane metabolism
    BMB171_C2248
Enzymes [BR:btb01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BMB171_C2248
Lipid biosynthesis proteins [BR:btb01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BMB171_C2248
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ADH07060
Position
2423075..2425015
Genome map
AA seq 646 aa AA seqDB search
MKQAVWFPTEEYKEKTRLYGWMKSLGYEDYETFYNKSIEETAWFWGEAEKAIGYQWMKPY
TDVLDLENGTPFAQWYNGGTCNVVESALSRWLADEETRIQPALQYEGENGTSKSFTYEEL
DNWVSRVANGLKHAGIEKGDRVTIYMPMIPETVVAMLAVMKIGAIISPIFSGFASDAVMT
RVQAAGSKMIITADGFSRRGKIVSLKDEVDKACEHCPTVEKVVIVRHAGNDFTPHNYDFS
WSTLEKEKPFIHAEEMQSDDPLMLIYTSGTTGKPKGTVHTHAGFPLKAAFDAGFGMNIKQ
GDRVLWVTDMGWMMGPFLLFGSLINGATMVMYEGVPDFPEADRLWETVDKYEITHLGISP
TLIRALMAKGDEYVNKHSLKSLEVFASTGEPWNPDPWMWLFETVGKGNVPICNYSGGTEI
SGGIFGNVLIKPIAPISFNASLPGMAAVVLDDQGKPIRDEVGELCLEKPWVGMTKSFWED
DERYVNTYWSRFENKWVHGDWVIYDGEQYIITGRSDDTLNIAGKRIGPAEYESILVKHND
VIEAAAIGVPDEVKGEVCHCFVVLRDHVTFTGELKKELMSLVNSHIGKALCPKDIHVVED
LPKTRNSKVMRRVIKAAYLGKELGDLSSLVNPEVVPFIQGLQSSKL
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
ttgaaacaagcagtttggtttccaacagaagagtacaaggaaaaaacacgtttatatggt
tggatgaaatcattgggatatgaagattatgaaactttttataataaatctatcgaggaa
acagcttggttttggggagaggcagaaaaggcaataggctatcaatggatgaaaccttat
acagacgtgttagatttagaaaatggtacaccgtttgcacagtggtataatggcggaaca
tgtaacgttgtagaatcagctttatcccgctggcttgcggatgaagagacgagaatacag
ccagcacttcagtacgaaggggaaaatggaacttcaaaatcatttacatatgaagagctt
gacaactgggtaagtcgtgttgcaaatggtttgaaacacgcgggtattgagaaaggtgac
cgtgtaacaatttatatgccgatgattccagaaacagttgttgcgatgctagctgtaatg
aaaatcggagcaattatttcaccaatattctcaggctttgcgtctgatgcagtcatgaca
cgtgtgcaagcggcaggttcaaaaatgattattaccgcagatggattttcacgccgaggt
aaaattgtttctttaaaagatgaagtagataaagcttgtgaacattgcccaactgttgaa
aaagttgttatcgttcgtcatgcaggaaatgattttacaccacataactatgacttttcg
tggagtacgctagaaaaagaaaaaccattcatacatgccgaggaaatgcaaagtgatgat
ccattaatgctcatttatacatcaggaacgactggtaagccgaaaggaacagtacacacg
catgcaggatttcctttgaaagcagcttttgatgcaggatttggaatgaatattaaacaa
ggtgatcgtgtattatgggtaactgatatgggctggatgatggggccgtttctattattc
ggttcactcattaatggagcaacgatggttatgtacgaaggtgttccagacttcccagaa
gcagaccggttatgggagacagttgataaatatgagattactcatctaggtatttcgcca
acgttaatccgagcattgatggcaaaaggtgatgagtatgtcaataaacattctttaaag
agtttggaagtattcgcatcaacaggagaaccttggaatcctgatccatggatgtggcta
tttgaaacggttggaaaaggaaatgtcccaatctgtaactactcaggtggaactgaaatc
tctggtgggattttcggtaatgttcttattaagccaatagcaccgattagttttaacgca
tctttaccaggaatggcagctgtcgtactggatgatcaaggtaaaccaattcgagatgaa
gtcggagaattatgcttagagaaaccttgggtaggtatgacgaaaagcttctgggaagat
gatgaacgttacgtaaacacatattggtcgcgttttgaaaataaatgggtccacggtgac
tgggtcatttacgatggtgaacaatatatcatcacagggcgttcagacgatacgttaaat
attgcaggtaaacgtattggacctgctgaatatgaatctattcttgtgaaacataacgat
gtaatcgaagctgctgcaattggtgtacctgacgaagtaaaaggtgaagtttgtcattgt
tttgtagtgttaagagatcatgtaacattcacaggagaattaaagaaagaattaatgagt
ttagtaaactctcatattggaaaagcgttgtgtcctaaagacatccacgttgtagaagat
ttaccgaaaacacgtaattctaaagtaatgcgccgtgttattaaagcagcttacttagga
aaagaattaggtgatttatcatcgcttgtaaatcctgaagttgttccgtttattcagggg
ttacagtctagtaaattataa

DBGET integrated database retrieval system