KEGG   Bacillus thuringiensis BMB171: BMB171_C2290Help
Entry
BMB171_C2290      CDS       T01239                                 

Definition
Zn-dependent alcohol dehydrogenase-like protein
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
btb  Bacillus thuringiensis BMB171
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:btb00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BMB171_C2290
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMB171_C2290
  Lipid metabolism
   00071 Fatty acid degradation
    BMB171_C2290
  Amino acid metabolism
   00350 Tyrosine metabolism
    BMB171_C2290
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BMB171_C2290
   00626 Naphthalene degradation
    BMB171_C2290
Enzymes [BR:btb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BMB171_C2290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2469892..2470818
Genome map
AA seq 308 aa AA seqDB search
MEQYKLIVKGPKQLEWETNEIKDIQDDEIIVKTIAGSISIGAELPQYNGFDVTDPHPFYP
RKTGYESYGEVIEVGNQVTHVNVGDKVVSFYGHETIGIVKAHKVIRVPSSIQPKIALLSI
LSCDAAKGVLKLNPRQDEKVLIIGMGVIGLLACYFLKYYVGIEHVDVVEPNKNRRDFAKK
FGTKNIYDSEEKIIETYNYGFECSATNSGFHTLQKALKTNGKICILSDGNIEELTLTANF
YQKELQIIGSSDGYDYQKHADWFFEEIGKTPFIEEIFQHEIHYTSLIQCFDELSLGIIKP
LKVYVSYE
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggaacaatataagttaattgtaaaagggcctaaacaacttgagtgggaaacaaatgaa
attaaggacatacaggacgatgaaattatcgttaaaacgatcgcaggatcgataagcatt
ggggccgagttaccacagtataatggattcgatgttacagatccgcatcctttttatcca
agaaaaactggatatgaaagttatggtgaagtgattgaagttggtaatcaagtaacacat
gtaaacgtaggtgataaagtagtttctttttatggacatgaaacgatagggatagttaag
gcgcataaagtaattcgagtgcctagttctatacaacctaaaattgctttattatctatt
ctttcatgtgatgccgctaaaggagtattgaaactaaacccgcgacaggatgaaaaagta
cttataattggaatgggagttattggtttactcgcttgttatttcttaaaatactatgta
ggcattgagcatgtggatgttgttgagcctaataaaaatagaagagattttgcaaagaag
tttggtacgaaaaacatatatgattcagaagagaaaataatagaaacatataattatggt
ttcgaatgttctgctacaaatagtgggttccatactttgcaaaaagctcttaaaactaat
ggtaaaatatgtatactgtctgatggtaatatagaagaactaacattaactgctaacttt
tatcagaaagaattacaaattattggatcaagtgacggatacgattatcaaaaacatgca
gattggttttttgaagaaataggaaaaacaccatttatagaggagatctttcaacatgaa
atacattatacttcactcatacaatgttttgatgaattgagtttagggataattaaacca
ttaaaagtatatgtttcatatgaataa

DBGET integrated database retrieval system