KEGG   Bacillus thuringiensis BMB171: BMB171_C2484Help
Entry
BMB171_C2484      CDS       T01239                                 

Gene name
acoC
Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
btb  Bacillus thuringiensis BMB171
Pathway
btb00010  Glycolysis / Gluconeogenesis
btb00020  Citrate cycle (TCA cycle)
btb00620  Pyruvate metabolism
btb01100  Metabolic pathways
btb01110  Biosynthesis of secondary metabolites
btb01120  Microbial metabolism in diverse environments
btb01130  Biosynthesis of antibiotics
btb01200  Carbon metabolism
Module
btb_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:btb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMB171_C2484 (acoC)
   00020 Citrate cycle (TCA cycle)
    BMB171_C2484 (acoC)
   00620 Pyruvate metabolism
    BMB171_C2484 (acoC)
Enzymes [BR:btb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BMB171_C2484 (acoC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 RnfC_N FAM76 GCV_H LIG3_BRCT
Motif
Other DBs
NCBI-ProteinID: ADH07296
Position
complement(2672189..2673388)
Genome map
AA seq 399 aa AA seqDB search
MAVEVVMPKLGMAMKEGIITSWNIKAGDNVAKGELIASINSEKIETEIEAPADGTVLDIA
VSEDEGVPPGTVICYIGKPNEKVEMQESTHVVEEKTSNIELQNVQNQEANGKEVSKQRIK
ISPVAKKIAKSENLDIKALVGTGPGGRITKADVLKALEVRGIVPEISEQEESNVIPVTGM
RKAIANRMHASLKNSAQLTLTMKVDVTDLVALHKEIAKIVQKRYDNKLTITDFVSRAAVL
ALGEHKEMNSAYIDDAIHQFEHVHLGMAVALEKGLIVPAIRFANNLSLVELSKEIKNVAQ
KARAGSLSSDDMHGTTFTISNLGSFGIEYFTPVLNTPETGILGIGAIEHVPVYKGKKLKK
GSMLPLSLTFDHRVLDGAPAAAFLRTIKHYLEEPITILL
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggctgtagaagttgtaatgccgaagttaggtatggcgatgaaagaaggtattattacg
agctggaatattaaagcaggcgataatgtagcaaaaggagaactaattgctagtattaat
tcagaaaaaattgaaacggaaattgaagcgccagctgatggtacggtacttgatatagct
gtaagtgaagatgaaggagtgccgcctggtactgtaatttgctacatcggtaaaccgaat
gaaaaggtagaaatgcaggaaagcacacatgttgtagaagaaaaaacatctaatatagaa
ttacaaaatgtacaaaatcaagaagcaaatgggaaagaagtatcgaagcaaagaattaaa
atttcacctgtagccaagaaaattgcaaagtctgaaaatctggatatcaaggcattagtt
ggtacaggtcctggcggaaggattacaaaggcagatgtattaaaagcacttgaggtaaga
ggaatcgttccggaaatatctgaacaagaagaaagtaacgtgattcctgttactggtatg
cgtaaagcgatcgcaaatcgtatgcacgcaagcttaaaaaatagcgcacaattaacgtta
acgatgaaagtagatgtaacagatttagttgctttacataaagaaatagcgaaaattgta
caaaaaagatatgataataaattaaccattacggattttgtctcgcgtgctgctgtatta
gcacttggagagcataaagaaatgaacagcgcttatatagatgatgcaattcatcaattt
gaacatgtgcatttaggcatggcagtcgcattagaaaaagggttaatcgttccagctatt
cgctttgcaaataatttatctttagtagaattgtctaaagagattaagaatgtggcacaa
aaggcgcgagcaggtagcttaagtagtgatgatatgcacggaacgacatttacaattagt
aatttaggtagctttggtattgaatatttcacacctgtattaaatacacctgagactggc
attttaggtattggcgcaattgaacatgttcctgtatataaagggaaaaaattaaaaaaa
ggtagtatgttacctttaagtttaacattcgatcatcgtgtactagacggtgcaccagca
gctgcatttttacgcacaattaaacattatttagaagaacctataacaattcttttataa

DBGET integrated database retrieval system