KEGG   Bacillus thuringiensis BMB171: BMB171_C2678Help
Entry
BMB171_C2678      CDS       T01239                                 

Gene name
proB
Definition
gamma-glutamyl kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
btb  Bacillus thuringiensis BMB171
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:btb01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:btb00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2854917..2856020)
Genome map
AA seq 367 aa AA seqDB search
MKKQRVVVKIGSSSLADSHGGISTEQLSDHVAALARLKEEGHEVVLITSGAVAAGFSALG
YPSRPVTIKGKQAAAAVGQSLLMQAYTEEFRKYGIVTAQLLLTRSDFSRKEQYSNAYATL
GELLNRSALPIINENDSISLEELTFGDNDMLSALVSGLVSADMLMIFTDVNGLYDKNPQK
NPDAKKYYFLPEVTEEISSLAGDAGSKLGTGGMKSKIDAAKTALSLGVSVFIGTGRGQEK
FVDVLKGKGDGTYVGNAPQKEMKMNKQWIALHSLVSGQIEVDAGAATAIIQHGKSLLPAG
VTNVSGFFQVGEVVEVVTQQGRVIGKGQCTYSAEELIDVKGMQSQDIQVRGERHSYEVIH
RDHWVSL
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaaacaacgagttgttgtaaagattgggagtagttccttggcagatagtcacgga
ggcatctctacagaacagctttcagatcacgttgccgcattggctcggttgaaagaagag
gggcacgaggttgtgttaattacatctggagccgtcgctgcaggtttttcagcgctagga
tatcctagcagacctgtaacgattaaagggaaacaggctgcagcagctgtcggacaaagt
ttgttaatgcaggcgtacacggaggaattccgtaaatatggcatcgttactgcgcaactt
ttgctgacgaggagtgatttttctagaaaagaacaatatagtaatgcttacgctacgtta
ggagaattattaaaccgctccgctcttccaattattaatgaaaatgattccatctcttta
gaggagctgacgttcggtgataatgatatgctgtcagctttagtaagcgggcttgtttcg
gcggatatgcttatgatctttacggatgtgaacgggttatatgacaaaaatcctcagaaa
aatccggatgcaaaaaaatattattttcttcctgaagttacggaagaaatttcttctctt
gcaggagatgctggctcaaaacttgggactggcggtatgaaatcaaaaatcgacgctgca
aagacagcgctctctcttggtgtgagtgtatttatcggaacaggacgtggacaggaaaag
tttgtagatgttttgaagggtaagggtgatggaacgtatgttggtaatgctcctcaaaaa
gaaatgaagatgaacaagcaatggattgccttacattcgcttgttagcggacaaattgaa
gtagatgctggggcagctactgccatcattcagcatggtaagagtttacttccagctggt
gttacgaatgtatcaggatttttccaagtgggtgaagttgtagaggttgtaacgcaacaa
gggcgcgtaataggaaaaggacaatgcacatatagtgcagaggaactaatagatgtaaaa
ggtatgcaaagccaagatattcaagtaagaggcgagagacatagttatgaagtcatccat
agggatcattgggtttcactttaa

DBGET integrated database retrieval system