KEGG   Bacillus thuringiensis BMB171: BMB171_C2920Help
Entry
BMB171_C2920      CDS       T01239                                 

Gene name
serC
Definition
(GenBank) phosphoserine aminotransferase
  KO
K00831  phosphoserine aminotransferase [EC:2.6.1.52]
Organism
btb  Bacillus thuringiensis BMB171
Pathway
btb00260  Glycine, serine and threonine metabolism
btb00680  Methane metabolism
btb00750  Vitamin B6 metabolism
btb01100  Metabolic pathways
btb01120  Microbial metabolism in diverse environments
btb01130  Biosynthesis of antibiotics
btb01200  Carbon metabolism
btb01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:btb00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    BMB171_C2920 (serC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BMB171_C2920 (serC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BMB171_C2920 (serC)
Enzymes [BR:btb01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.52  phosphoserine transaminase
     BMB171_C2920 (serC)
Amino acid related enzymes [BR:btb01007]
 Aminotransferase (transaminase)
  Class V
   BMB171_C2920 (serC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 DUF2130 Clr5
Motif
Other DBs
NCBI-ProteinID: ADH07730
Position
complement(3131820..3133073)
Genome map
AA seq 417 aa AA seqDB search
MYLTLFYMSIKKSALASDSIASCALIIENKLTTYYILGYNSESLKNNPMRNREVMRVMER
VYNFSAGPSILPLPVLEKVQKELLNYNGTGMSIMEMSHRSSYFQSIIEEASNLLRELMSI
PDEYEVLFLQGGASLQFSMIPLNLMNTYKKAGYVLTGSWSKKALQEAEKVGEVQVIASSE
QEKFTKIPKLDGLLSDEKLDYVHITTNNTIEGTKYVGIPHVERVPLVADMSSNILSEQYD
VSKFGLIYAGAQKNLGPAGLTIAIIKRDLIGGADRSCPTMLNYETYSKNNSLYNTPPSFS
IYVTKLVLEWLKEQGGVSAIEEQNRMKSSLIYHFLDESKLFTSPVDPAYRSLMNIPFTTP
SEELNNEFLQKAKERGLVTLKGHRSVGGMRASIYNAMPVQGVQQLVNYMKEFELENR
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgtacttaacacttttttatatgtccataaaaaagtctgcacttgcaagcgattccatc
gcgtcttgcgccctaataatagaaaacaaattgaccacatattatattttgggttataat
tcagaaagtttaaaaaataatccgatgagaaatagggaggttatgagggtaatggagaga
gtctataatttttcagcaggaccatcaatactccctttgccagttttagagaaagtgcaa
aaggagctattaaattataacgggacaggcatgtctattatggaaatgagtcatcgatct
tcttattttcaaagtattatagaggaagcgagtaacttacttcgtgaattaatgagcatc
cctgatgagtatgaagttttatttttacaaggcggtgcgtcattacaattctctatgata
ccgttgaacttaatgaatacgtataaaaaagctggatacgtactaactggctcatggtct
aaaaaggcattgcaagaagccgaaaaagttggggaagtacaagtgattgcttcttccgag
caagagaagtttactaagattcctaaactggacggtttactaagcgatgaaaaactagat
tatgtacatattacaacgaataatacaattgaagggacaaaatatgtgggaattccacat
gtagaaagagtgccgctcgttgcggatatgtcttcaaatattttgtcagaacaatatgat
gtttcgaagtttggtcttatatatgcgggggcgcaaaagaatttaggacctgcgggctta
acgattgcgattataaaaagagatttaatcgggggagcagatcgctcttgtccgacaatg
ttaaattatgaaacttacagtaaaaataactccttatataatacaccgccatcctttagt
atttacgtaacaaaacttgtactagagtggttgaaagagcaaggcggagtatctgcgatt
gaagaacaaaatagaatgaaatcttcacttatttatcattttttagatgaatctaaattg
tttacttcaccagttgatcctgcgtatcgatcacttatgaacattccgtttacaacaccg
tcagaagaacttaacaatgagtttttacaaaaagcgaaggaacgcggccttgttacgtta
aaaggacatcgatcagtcggtggtatgcgcgctagtatttacaatgcgatgccagtacaa
ggcgtacagcaattagtaaattatatgaaggaatttgagcttgagaatagatag

DBGET integrated database retrieval system