KEGG   Bacillus thuringiensis BMB171: BMB171_C2920Help
Entry
BMB171_C2920      CDS       T01239                                 

Gene name
serC
Definition
phosphoserine aminotransferase
Orthology
K00831  
phosphoserine aminotransferase [EC:2.6.1.52]
Organism
btb  Bacillus thuringiensis BMB171
Pathway
Glycine, serine and threonine metabolism
Methane metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:btb01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:btb01230]
Metabolism; Energy metabolism; Methane metabolism [PATH:btb00680]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:btb00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:btb00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3131820..3133073)
Genome map
AA seq 417 aa AA seqDB search
MYLTLFYMSIKKSALASDSIASCALIIENKLTTYYILGYNSESLKNNPMRNREVMRVMER
VYNFSAGPSILPLPVLEKVQKELLNYNGTGMSIMEMSHRSSYFQSIIEEASNLLRELMSI
PDEYEVLFLQGGASLQFSMIPLNLMNTYKKAGYVLTGSWSKKALQEAEKVGEVQVIASSE
QEKFTKIPKLDGLLSDEKLDYVHITTNNTIEGTKYVGIPHVERVPLVADMSSNILSEQYD
VSKFGLIYAGAQKNLGPAGLTIAIIKRDLIGGADRSCPTMLNYETYSKNNSLYNTPPSFS
IYVTKLVLEWLKEQGGVSAIEEQNRMKSSLIYHFLDESKLFTSPVDPAYRSLMNIPFTTP
SEELNNEFLQKAKERGLVTLKGHRSVGGMRASIYNAMPVQGVQQLVNYMKEFELENR
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgtacttaacacttttttatatgtccataaaaaagtctgcacttgcaagcgattccatc
gcgtcttgcgccctaataatagaaaacaaattgaccacatattatattttgggttataat
tcagaaagtttaaaaaataatccgatgagaaatagggaggttatgagggtaatggagaga
gtctataatttttcagcaggaccatcaatactccctttgccagttttagagaaagtgcaa
aaggagctattaaattataacgggacaggcatgtctattatggaaatgagtcatcgatct
tcttattttcaaagtattatagaggaagcgagtaacttacttcgtgaattaatgagcatc
cctgatgagtatgaagttttatttttacaaggcggtgcgtcattacaattctctatgata
ccgttgaacttaatgaatacgtataaaaaagctggatacgtactaactggctcatggtct
aaaaaggcattgcaagaagccgaaaaagttggggaagtacaagtgattgcttcttccgag
caagagaagtttactaagattcctaaactggacggtttactaagcgatgaaaaactagat
tatgtacatattacaacgaataatacaattgaagggacaaaatatgtgggaattccacat
gtagaaagagtgccgctcgttgcggatatgtcttcaaatattttgtcagaacaatatgat
gtttcgaagtttggtcttatatatgcgggggcgcaaaagaatttaggacctgcgggctta
acgattgcgattataaaaagagatttaatcgggggagcagatcgctcttgtccgacaatg
ttaaattatgaaacttacagtaaaaataactccttatataatacaccgccatcctttagt
atttacgtaacaaaacttgtactagagtggttgaaagagcaaggcggagtatctgcgatt
gaagaacaaaatagaatgaaatcttcacttatttatcattttttagatgaatctaaattg
tttacttcaccagttgatcctgcgtatcgatcacttatgaacattccgtttacaacaccg
tcagaagaacttaacaatgagtttttacaaaaagcgaaggaacgcggccttgttacgtta
aaaggacatcgatcagtcggtggtatgcgcgctagtatttacaatgcgatgccagtacaa
ggcgtacagcaattagtaaattatatgaaggaatttgagcttgagaatagatag

DBGET integrated database retrieval system