KEGG   Bacillus thuringiensis BMB171: BMB171_C3430Help
Entry
BMB171_C3430      CDS       T01239                                 

Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
btb  Bacillus thuringiensis BMB171
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:btb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMB171_C3430
Enzymes [BR:btb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     BMB171_C3430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3646027..3647436)
Genome map
AA seq 469 aa AA seqDB search
MKFPHDFLFGAASASYQVEGAWNEDGKGVTNWDEFSKIPGKTYNGTNGDVAVDHYHRYKE
DVRLMAEMGLESYRFSISWARILPTGDGKVNEKGIEFYNNLIDECLKYGIVPFVTLYHWD
LPLPLEKDGGWTNKRTAEAFVKYAETCFKAFGDRVKHWITFNETVMFCGLGYLKGAHPPG
IQNDVPKYFQATHYVFYAHAKTVAVYKQLKQYGEIGITHVFLPAYSVDDQKENIQAANHA
NEYETYWYYDPILKGEYPSYVVQQLKEKGWTPNWTVEELEIIKQNAEENDFIGLNYYQPI
RVERYDMDIKSEEHSRENSTLAPGNPSFDGFYRTVKMDDKTYTKWGWEISPEGFLEGLHM
LKARYGDIKMYVTENGLGDEDPIIDGEIVDVPRIKFIEAHLKVMKRAIEEGINLKGYYAW
SVIDLLSWLNGYKKQYGFIFVDHNDNLKRKKKLSFHWYKRVVETRGEEL
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttccacatgattttttattcggagctgcttcagcttcttatcaagtagaaggt
gcatggaatgaagacggaaaaggtgttacgaattgggacgagttttcaaaaattcctggc
aaaacatacaatggaacaaatggtgatgtagctgttgatcattatcatcgatataaggaa
gatgttcgcttaatggctgagatgggattagaatcgtatcgtttttctatttcttgggcg
agaatattgccgactggagatggaaaggtaaatgaaaaagggattgaattttataacaac
ttaattgatgaatgtttaaaatacgggattgtgccgtttgtcactttatatcattgggat
ttaccattaccgttagaaaaagatggtggatggacgaataaaagaacagcagaggctttc
gtaaaatatgcagaaacttgttttaaggcatttggtgacagagttaagcattggattact
tttaatgagaccgtaatgttttgtggattaggttatttaaaaggtgcacatccaccagga
atacaaaatgatgttccaaagtattttcaagcgactcattatgtattttatgcacacgcg
aaaacagttgcggtgtacaagcagctgaaacaatatggtgagattgggattacacatgtt
ttcttaccagcttatagtgtggatgatcaaaaagaaaatatacaagcagcaaatcatgcg
aatgaatatgaaacgtattggtattatgatccaattttaaaaggcgagtatccgtcttat
gttgtacaacaattaaaggaaaaaggatggactcctaattggacggttgaagaattagaa
atcattaaacaaaatgcagaagaaaatgattttattggcttgaattattatcaaccaata
cgagtagaaagatacgatatggatataaagagtgaggaacattctcgagaaaactcaacg
cttgctccaggtaacccttcttttgatggtttttatcgaacagttaaaatggatgataaa
acatatacaaaatggggatgggaaatatctcccgaaggtttcttagagggattgcatatg
ttgaaagcgcgttacggtgacataaagatgtatgtaacggaaaatggacttggtgatgaa
gatccaatcattgacggagaaattgtagatgttccgagaattaaatttattgaagcgcat
ttaaaagtaatgaagcgtgcaattgaagagggaattaacttaaaaggttattatgcatgg
tcagtgattgatcttttaagttggttaaatggatataaaaagcaatatggctttattttt
gtcgatcataatgataacttaaaacgtaagaagaaactttcgtttcattggtataaacgt
gtggtcgaaacgagaggggaagagttataa

DBGET integrated database retrieval system