KEGG   Bacillus thuringiensis BMB171: BMB171_C3703Help
Entry
BMB171_C3703      CDS       T01239                                 

Definition
2-hydroxy-3-oxo-5-methylthiopent-2-enoate oxidase
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
btb  Bacillus thuringiensis BMB171
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:btb00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3935637..3936149
Genome map
AA seq 170 aa AA seqDB search
MAQIRIHEVNTRIENEVEVSKFLQEEGVLYEKWNISKLPTHLNENYSLTDENKAEILAIF
SKEIADVSARRGYKAHDVISLSSSTPNLDELLINFQKEHHHTDDEVRFIVSGHGIFAIEG
KDGKFFDVELEPGDLISVPENARHYFTLQDDRQVVAIRIFVTTEGWVPIY
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaaattcgtattcatgaagtaaatactcgtattgaaaatgaagtggaagtatct
aaatttctacaagaggaaggcgttttatatgagaaatggaatatttctaaacttcctact
catttaaatgaaaattattcgttaacagatgaaaacaaagctgaaatattagctattttt
tcaaaagaaatcgctgatgtttcagcacgtcgaggttataaagcacatgatgtaatctca
ctttcaagtagcacacctaaccttgacgaattattaattaatttccaaaaggaacaccat
catacagatgacgaagttcgctttatcgtcagtggtcacggcattttcgctattgaaggt
aaagatgggaaattctttgatgttgaacttgagccaggcgatttaatatctgttcctgaa
aatgcaagacattattttaccttgcaagatgatcgccaagttgtagctattcgtattttt
gtgacaactgaaggctgggttccaatctattaa

DBGET integrated database retrieval system