KEGG   Bacillus thuringiensis BMB171: BMB171_C4058Help
Entry
BMB171_C4058      CDS       T01239                                 

Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
btb  Bacillus thuringiensis BMB171
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:btb00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BMB171_C4058
Enzymes [BR:btb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     BMB171_C4058
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4259770..4261857)
Genome map
AA seq 695 aa AA seqDB search
MVETFKKELPQTKAGMVQYLASDLFKGIGKRTAEKIVDHLGEHAISKIMDDPEALNGVVN
KQKAQEIYETIVEHQGLEKVMSFLNGYGFGTKLSIKIYQQYKEMTLEVIRNNPYQLIEEV
DGIGFGRADDIGRALGISGNHDDRVRAGCFYTLENVSLQLGHVYMRKDQLVRETMSLLNN
QEGRVTEEDIIGCIETMQSEGKVIIEEERVYLATLFYSEKGVVKSIRRLMNQEETPSFPE
AEVLKTLGEIEEQLNVQYAPFQQEAIQTALHKPMMLLTGGPGTGKTTVIKGIVEMYASLH
GLSLNPNEYSDDNPFPILLTAPTGRAAKRMSESTGLPACTIHRLLGWTPEGSFQRNETDP
VQGKLLIIDEFSMVDIWLANQLFKSLPTNIQVIVVGDEDQLPSVGPGQVLKDLLNAGAVP
TVKLTEIYRQAEGSSVIQLAHAIKNGTLPPDLAQNKKDRSFISCTGAQIVEVVKKVCENA
KTKGFSARDVQVLAPMYRGPAGINVLNEALQQVFNPKREKSKEIAYGDVVYRRGDKVLQL
VNQPESQVFNGDIGEIVSVFYAKENVEQQDMIIVSFDGIEVTYTKPDLNQITHAYCCSIH
KSQGSEFPIVIMPIVKSYNRMLRRNLIYTGITRSKKFLIICGEEAAFQSGVNRLDDAMRQ
TTLASRLQESQGEVQMVTVNGEEMDVENISPYDFM
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atggttgaaacatttaaaaaagaattgccgcaaacaaaagcaggtatggtgcaatattta
gcgagtgatttatttaaagggataggaaagcgtacagctgaaaaaattgtggaccatctc
ggagaacatgctatttctaaaattatggatgaccctgaggcattaaatggtgttgttaat
aaacaaaaggctcaggaaatatatgagacaattgttgaacatcaaggattagagaaagta
atgagctttttaaatggctacggttttggaacgaaactttctattaagatttaccagcaa
tataaagagatgacattagaagtgattcgtaataatccgtatcaacttattgaagaagtg
gacgggattggttttggaagagcggatgatatagggcgtgcgttagggatatcgggtaat
catgacgaccgtgtacgagcgggatgtttttacacattagagaatgtctcattacaactt
ggtcatgtttatatgaggaaagatcaacttgtaagagaaacgatgtcacttttaaacaat
caagaaggaagagtgactgaggaagatattataggttgtattgaaacgatgcaaagtgaa
gggaaagtcatcatagaagaagaacgagtgtatttagcgacgttattctactctgaaaaa
ggtgttgtaaagtctattcgcaggcttatgaatcaagaagaaacaccttcatttccagaa
gcggaagtgttaaaaacgttaggtgaaattgaagaacaactgaacgtacaatatgcaccg
tttcagcaagaagcaattcaaacggcacttcataaaccgatgatgttattgacaggtgga
ccaggaacagggaaaacaacagttattaaagggattgttgaaatgtatgcgtcacttcac
ggattatcgttaaatccgaatgaatacagtgatgataatccatttccaatactattaaca
gctccaacaggaagagcagcgaagcggatgagtgaatcgacaggacttccagcttgcaca
attcaccgtttacttggttggacgccagaaggatctttccagcgtaatgaaacggatcct
gtccaaggtaagctccttattatcgatgaattttcaatggttgatatttggcttgcaaat
cagctatttaagtcgttgccgacgaatattcaagttatcgttgtaggtgatgaagatcag
ttgccatctgtaggacctggacaagtattaaaagatttattaaatgcaggcgcagttccg
acagtgaagcttactgaaatttatcgtcaagcggaaggctcatcagtgattcaacttgcc
catgcgataaaaaatggaactctaccaccagatttagcgcaaaacaaaaaagatcgttcg
tttatcagctgtacaggggctcaaattgttgaggttgtgaaaaaagtttgcgaaaatgct
aaaacaaaaggctttagtgcaagggatgttcaagtattagcaccgatgtaccgcgggcct
gctggtattaatgtattaaacgaagcgctgcaacaagtatttaatccgaagagggaaaag
agtaaagaaattgcttacggcgatgttgtgtaccgaagaggcgataaagtactgcaactc
gtgaatcagccggagagccaagtgtttaatggtgatattggggaaattgtttcggtgttt
tatgcgaaagagaacgttgagcaacaagatatgattatcgtttcatttgatggaattgag
gtaacgtatacgaagcccgatttaaatcaaattacgcatgcatattgttgttccattcat
aaatcacaaggtagtgaatttccgattgttattatgccaatcgtgaaaagttacaaccgt
atgttacgtcgtaatttaatttacacgggtattacaagaagtaagaagttccttattatt
tgtggggaggaagcagctttccaatctggtgtaaatcgccttgatgatgcaatgcgtcaa
acaactttagctagtcgcttgcaagaatcacaaggagaagtacagatggtcacagttaat
ggcgaggaaatggacgtggaaaacatttcaccgtatgatttcatgtaa

DBGET integrated database retrieval system