KEGG   Bacillus thuringiensis BMB171: BMB171_C4241Help
Entry
BMB171_C4241      CDS       T01239                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
btb  Bacillus thuringiensis BMB171
Pathway
btb00010  Glycolysis / Gluconeogenesis
btb00030  Pentose phosphate pathway
btb00051  Fructose and mannose metabolism
btb00052  Galactose metabolism
btb00680  Methane metabolism
btb01100  Metabolic pathways
btb01110  Biosynthesis of secondary metabolites
btb01120  Microbial metabolism in diverse environments
btb01130  Biosynthesis of antibiotics
btb01200  Carbon metabolism
btb01230  Biosynthesis of amino acids
btb03018  RNA degradation
Module
btb_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:btb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMB171_C4241 (pfkA)
   00030 Pentose phosphate pathway
    BMB171_C4241 (pfkA)
   00051 Fructose and mannose metabolism
    BMB171_C4241 (pfkA)
   00052 Galactose metabolism
    BMB171_C4241 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    BMB171_C4241 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    BMB171_C4241 (pfkA)
Enzymes [BR:btb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BMB171_C4241 (pfkA)
Protein phosphatases and associated proteins [BR:btb01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BMB171_C4241 (pfkA)
Messenger RNA biogenesis [BR:btb03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     BMB171_C4241 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK Peripla_BP_1 NAD_kinase
Motif
Other DBs
NCBI-ProteinID: ADH09050
Position
complement(4456816..4457775)
Genome map
AA seq 319 aa AA seqDB search
MKRIGVLTSGGDSPGMNAAIRAVVRKAIFHDIEVYGIYHGYAGLISGHIEKLELGSVGDI
IHRGGTKLYTARCPEFKDPEVRLKGIEQLKKHGIEGLVVIGGDGSYQGAKKLTEQGFPCV
GVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWA
GLADGAETILIPEEEYDMDDVIARLKRGSERGKKHSIIVVAEGVGSAIDIGKHIEEATNF
DTRVTVLGHVQRGGSPSAQDRVLASRLGARAVELLIAGKGGRCVGIQDNKLVDHDIIEAL
AQKHTIDKDMYQLSKELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattggtgtattaacaagtggtggagattcacctggtatgaatgctgccatt
cgtgcagttgttcgtaaagcgattttccatgatattgaagtatatggtatttaccatgga
tacgctggattaatttctggtcacattgaaaaattagaacttggttctgttggcgatatt
atccaccgcggtggtacaaaattatatacagcaagatgtcctgagtttaaagatccagaa
gtacgactaaaaggtatcgagcaattaaagaaacacggtatcgaaggacttgttgttatt
ggtggagatggttcttaccaaggcgctaaaaaattaactgaacaaggattcccatgtgtt
ggtgtaccaggtacaatcgacaatgatatccctggaacagacttcacaattggtttcgat
acagctttaaacactgttattgatgcaattgataaaattcgtgacacagctacatctcat
gaacgtacatatgttatcgaagtaatgggacgtcacgctggtgatatcgcattatgggct
ggtttagcagatggtgcggaaacgatcttaattccagaagaagagtatgacatggatgat
gttatcgctcgtctgaagcgtggtagtgaacgtggtaaaaaacacagtattatcgttgta
gctgaaggtgttggaagtgcaattgacatcggtaagcacattgaagaagcaacaaacttt
gatactcgtgtaactgtattaggtcacgtacaacgtggtggatcaccaagtgcacaagac
cgtgtattagcaagtcgtcttggcgcaagagcagttgaattattaattgctggtaaaggc
ggacgttgtgtaggtattcaagataacaaacttgttgatcatgacattatcgaagcgtta
gctcaaaagcatacaatcgataaagacatgtatcaattatctaaagaattatccatctaa

DBGET integrated database retrieval system